IKMC Project Report - KOMP-CSD (ID: 79294)

A630007B06Rik MGI:2445022 ENSMUSG00000035173 OTTMUSG00000028286
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000118592 protein_coding No protein product (NMD) view

Predicted translation: 

MKIRSRFEEMQSELVPVSMSETEHIASISSDATTEKTSELRDDSCISVSGDESSRLETGAELLSLDSDRILCQTNEHCSQ
IEVQESHIPDCGSGENSCANTDTCPEDSGQIDDFPGGDFTEQVSKTKEPEQTVTQILAELKSSAPAEAANPKTASASLYD
TDCTRKLISEMKTVSASDDLLGEIESELLSAEFAEGHQVPNGLNKGEQALALFEKCVHSRYLQQELTVKH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000710741 UTR UTR
ENSMUSE00000721715 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000344770 CDS Deleted
ENSMUSE00001055617 CDS CDS + stop codon + UTR
ENSMUSE00000360200 CDS
ENSMUSE00001071515 CDS
ENSMUSE00001015654 CDS
ENSMUSE00001075127 CDS
ENSMUSE00000992933 CDS
ENSMUSE00001049239 CDS
ENSMUSE00001010037 CDS
ENSMUSE00000640599 CDS
ENSMUSE00000971212 CDS
ENSMUSE00000474111 CDS
ENSMUSE00000466007 CDS
ENSMUSE00000709694 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000076085 protein_coding No analysis available: incomplete transcript
ENSMUST00000135666 protein_coding Target region does not overlap transcript
ENSMUST00000140184 retained_intron No analysis available: incomplete transcript
ENSMUST00000156708 retained_intron Target region does not overlap transcript
ENSMUST00000140705 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0623_1_F10 HTGRS6014_A_C06 A630007B06Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0623_1_A10 HTGRS6014_A_C06 A630007B06Riktm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0623_1_H11 HTGRS6014_A_C06 A630007B06Riktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 46212 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGRS6014_A_C06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 46212 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06014_A_7_C06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 46212 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06014_A_4_C06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 46212 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06014_A_6_C06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 46212 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06014_A_5_C06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 46212 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06014_A_3_C06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
46212 Knockout First, Reporter-tagged insertion with conditional potential PCS6014_A_C06