IKMC Project Report - KOMP-CSD (ID: 79312)

Akr1c21 MGI:1924587 ENSMUSG00000021207 OTTMUSG00000027696
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000021628 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation:

MNSKCHCVILNDGNFIPVLGFGTALPLEVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLG
SMAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRYIPAAIFKGHPNWPFLDE
Y*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000489334 NADP_OxRdtase_dom (9/282 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000501315 NADP_OxRdtase_dom (56/282 aa) CDS Deleted
ENSMUSE00000495791 NADP_OxRdtase_dom (39/282 aa) CDS Deleted
ENSMUSE00001069918 NADP_OxRdtase_dom (26/282 aa) CDS Deleted
ENSMUSE00000989159 NADP_OxRdtase_dom (41/282 aa) CDS Deleted
ENSMUSE00001044094 NADP_OxRdtase_dom (37/282 aa) CDS CDS
ENSMUSE00000997876 NADP_OxRdtase_dom (56/282 aa) CDS CDS
ENSMUSE00001091665 NADP_OxRdtase_dom (19/282 aa) CDS CDS
ENSMUSE00000446743 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000137279 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0604_2_G11 HTGRS6005_A_D02 Akr1c21tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0604_2_E10 HTGRS6005_A_D02 Akr1c21tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0604_2_A09 HTGRS6005_A_D02 Akr1c21tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 103078 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06005_A_1_D02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 103078 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06005_A_2_D02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 103078 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGRS6005_A_D02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 103078 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06005_A_7_D02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 103078 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06005_A_6_D02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 103078 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06005_A_5_D02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 103078 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06005_A_3_D02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
103078 Knockout First, Reporter-tagged insertion with conditional potential PCS6005_A_D02