IKMC Project Report - KOMP-CSD (ID: 79338)

Tbc1d8b MGI:1918101 ENSMUSG00000042473 OTTMUSG00000018731
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000096313 protein_coding No protein product (NMD) view

Predicted translation:

MWLKPEEVLLKNALKLWLMERSNEYFVLQRRRGYGEEGGGGLTGLLVGTLDSVLDSTAKVAPFRILHQTPDSQVYLSIAC
GANREEITKHWDWLEQNIMKTLSVFDSNEDITNFVQGKIRLNSLSPGMQSQNLKRLQLLY*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000693996 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000693995 CDS CDS
ENSMUSE00000693994 CDS CDS
ENSMUSE00000693993 GRAM (50/66 aa) CDS Deleted
ENSMUSE00000693991 GRAM (17/66 aa) CDS CDS + stop codon + UTR
ENSMUSE00000693989 GRAM (60/67 aa) CDS
ENSMUSE00000693988 GRAM (7/67 aa) CDS
ENSMUSE00000693987 CDS
ENSMUSE00000653554 Rab-GTPase-TBC_dom (11/204 aa) CDS
ENSMUSE00000259757 Rab-GTPase-TBC_dom (72/204 aa) CDS
ENSMUSE00000502884 Rab-GTPase-TBC_dom (40/204 aa) CDS
ENSMUSE00000259745 Rab-GTPase-TBC_dom (83/204 aa) CDS
ENSMUSE00000259742 CDS
ENSMUSE00001010088 CDS
ENSMUSE00001005745 CDS
ENSMUSE00000973588 CDS
ENSMUSE00001069668 CDS
ENSMUSE00000259669 CDS
ENSMUSE00000259663 CDS
ENSMUSE00000259680 CDS
ENSMUSE00000545542 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000123430 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06015_A_5_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06002_A_4_A01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06015_A_6_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06002_A_5_A01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06002_A_3_A01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06002_A_1_A01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06002_A_7_A01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGRS6002_A_A01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06015_A_7_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06002_A_6_A01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGRS6015_A_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06015_A_1_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06002_A_8_A01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06015_A_8_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06015_A_4_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06015_A_2_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06002_A_2_A01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 86314 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06015_A_3_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
86314 Knockout First, Reporter-tagged insertion with conditional potential PCS6015_A_A08
86314 Knockout First, Reporter-tagged insertion with conditional potential PCS6002_A_A01