IKMC Project Report - KOMP-CSD (ID: 79368)

Wt1 MGI:98968 ENSMUSG00000016458 OTTMUSG00000014987
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000146842 protein_coding No protein product (NMD) view

Predicted translation: 

MGSDVRDLNALLPAVSSLGGGGGGCGLPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAPPPPPPPPHSFIKQEPSWGG
AEPHEEQCLSAFTLHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPTIRNQGYSTVTFDGAPSY
GHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSRMCGVYLEWPQLLSGQHL
KPVRNVLSCVHTQAAIRDILSCPTYRCIAGSTLVRNHTSVTSRTAREGFLAQTSSKDTKGDTQV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000765900 Wilms_tumour_N (147/224 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000166515 Wilms_tumour_N (42/224 aa) CDS CDS
ENSMUSE00000166517 Wilms_tumour_N (35/224 aa) | Wilms_tumour_N (1/57 aa) CDS CDS
ENSMUSE00000372552 Wilms_tumour_N (3/224 aa) | Wilms_tumour_N (33/57 aa) CDS Deleted
ENSMUSE00001089277 Wilms_tumour_N (24/57 aa) CDS CDS
ENSMUSE00001031077 Znf_C2H2 (25/25 aa) CDS CDS
ENSMUSE00000166514 Znf_C2H2 (23/23 aa) CDS CDS + stop codon + UTR
ENSMUSE00000740766 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000133470 protein_coding No protein product (NMD) view

Predicted translation: 

MGSDVRDLNALLPAVSSLGGGGGGCGLPVSGAAQWAPVLDFAPPGASAYGSLGGPAPPPAPPPPPPPPHSFIKQEPSWGG
AEPHEEQCLSAFTLHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPTIRNQGYSTVTFDGAPSY
GHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQ
MNLGATLKGMCGVYLEWPQLLSGQHLKPVRNVLSCVHTQAAIRDILSCPTYRCIAGSTLVRNHTSVTSRTAREGFLAQTS
SKDTKGDTQV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000843084 Wilms_tumour_N (147/304 aa) CDS CDS
ENSMUSE00000166515 Wilms_tumour_N (42/304 aa) CDS CDS
ENSMUSE00000166517 Wilms_tumour_N (35/304 aa) CDS CDS
ENSMUSE00000166523 Wilms_tumour_N (27/304 aa) CDS CDS
ENSMUSE00000372552 Wilms_tumour_N (33/304 aa) CDS Deleted
ENSMUSE00001089277 Wilms_tumour_N (24/304 aa) CDS CDS
ENSMUSE00001031077 Znf_C2H2 (25/25 aa) CDS CDS
ENSMUSE00000166514 Znf_C2H2 (23/23 aa) CDS CDS + stop codon + UTR
ENSMUSE00000813392 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000111099 protein_coding No protein product (NMD) view

Predicted translation: 

MEKGYSTVTFDGAPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSD
NLYQMTSQLECMTWNQMNLGATLKGMAAGSSSSVKWTEGQSKMCGVYLEWPQLLSGQHLKPVRNVLSCVHTQAAIRDILS
CPTYRCIAGSTLVRNHTSVTSRTAREGFLAQTSSKDTKGDTQV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000686662 Wilms_tumour_N (1/175 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000166515 Wilms_tumour_N (42/175 aa) CDS CDS
ENSMUSE00000166517 Wilms_tumour_N (35/175 aa) CDS CDS
ENSMUSE00000166523 Wilms_tumour_N (27/175 aa) CDS CDS
ENSMUSE00000166516 Wilms_tumour_N (18/175 aa) CDS CDS
ENSMUSE00000372552 Wilms_tumour_N (33/175 aa) CDS Deleted
ENSMUSE00001089277 Wilms_tumour_N (24/175 aa) CDS CDS
ENSMUSE00001031077 Znf_C2H2 (25/25 aa) CDS CDS
ENSMUSE00000686661 Znf_C2H2 (23/23 aa) CDS CDS + stop codon + UTR
ENSMUSE00000686660 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000111098 protein_coding No protein product (NMD) view

Predicted translation: 

MEKGYSTVTFDGAPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSD
NLYQMTSQLECMTWNQMNLGATLKGMCGVYLEWPQLLSGQHLKPVRNVLSCVHTQAAIRDILSCPTYRCIAGSTLVRNHT
SVTSRTAREGFLAQTSSKDTKGDTQV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000686662 Wilms_tumour_N (1/158 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000166515 Wilms_tumour_N (42/158 aa) CDS CDS
ENSMUSE00000166517 Wilms_tumour_N (35/158 aa) CDS CDS
ENSMUSE00000166523 Wilms_tumour_N (27/158 aa) CDS CDS
ENSMUSE00000372552 Wilms_tumour_N (33/158 aa) CDS Deleted
ENSMUSE00001089277 Wilms_tumour_N (24/158 aa) CDS CDS
ENSMUSE00001031077 Znf_C2H2 (25/25 aa) CDS CDS
ENSMUSE00000166514 Znf_C2H2 (23/23 aa) CDS CDS + stop codon + UTR
ENSMUSE00000225423 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000143043 protein_coding No analysis available: incomplete transcript
ENSMUST00000139585 protein_coding No analysis available: incomplete transcript
ENSMUST00000145107 retained_intron Target region does not overlap transcript
ENSMUST00000153944 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0798_2_A07 HTGR06009_A_1_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_B02 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_F04 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_D04 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_C04 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_A03 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_B04 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_D03 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_G04 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_C01 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_C02 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_B03 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_C03 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0846_3_E03 HTGRS06009_A_B04 Wt1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 209396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06009_A_1_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 209396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS06009_A_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 209396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06009_A_5_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 209396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06009_A_6_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 209396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06009_A_7_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 209396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06009_A_4_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 209396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06009_A_8_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 209396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06009_A_3_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 209396 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06009_A_2_B04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
209396 Knockout-First - Reporter Tagged Insertion PCS6009_A_B04