IKMC Project Report - KOMP-CSD (ID: 79567)

Mtss1l MGI:3039591 ENSMUSG00000033763 OTTMUSG00000027473
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Mtss1ltm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) EPD0623_2_B04 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000052457 protein_coding No protein product (NMD) view

Predicted translation: 

METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKAAKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTR
MCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKARKGDQRPEGF
*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000496434 IRSp53/MIM_homology_IMD (8/222 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000978407 IRSp53/MIM_homology_IMD (21/222 aa) CDS CDS
ENSMUSE00001023175 IRSp53/MIM_homology_IMD (26/222 aa) CDS CDS
ENSMUSE00000983139 IRSp53/MIM_homology_IMD (29/222 aa) CDS CDS
ENSMUSE00001077758 IRSp53/MIM_homology_IMD (32/222 aa) CDS CDS
ENSMUSE00001087440 IRSp53/MIM_homology_IMD (26/222 aa) CDS CDS
ENSMUSE00001060402 IRSp53/MIM_homology_IMD (53/222 aa) CDS Deleted
ENSMUSE00001000582 IRSp53/MIM_homology_IMD (32/222 aa) CDS Deleted
ENSMUSE00000975760 CDS CDS + stop codon + UTR
ENSMUSE00000514848 CDS
ENSMUSE00000392209 CDS
ENSMUSE00000349861 CDS
ENSMUSE00000311736 CDS
ENSMUSE00000347347 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000144041 protein_coding No protein product (NMD) view

Predicted translation: 

MATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQLDKDHAKEYKRARHEIKKKSSD
TLKLQKKARKGDQRPEGF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000757751 UTR UTR
ENSMUSE00001058262 UTR UTR
ENSMUSE00001005247 IRSp53/MIM_homology_IMD (6/174 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000983139 IRSp53/MIM_homology_IMD (29/174 aa) CDS CDS
ENSMUSE00001077758 IRSp53/MIM_homology_IMD (32/174 aa) CDS CDS
ENSMUSE00001087440 IRSp53/MIM_homology_IMD (26/174 aa) CDS CDS
ENSMUSE00001060402 IRSp53/MIM_homology_IMD (53/174 aa) CDS Deleted
ENSMUSE00001000582 IRSp53/MIM_homology_IMD (32/174 aa) CDS Deleted
ENSMUSE00000975760 CDS CDS + stop codon + UTR
ENSMUSE00000514848 CDS
ENSMUSE00000392209 CDS
ENSMUSE00000349861 CDS
ENSMUSE00000311736 CDS
ENSMUSE00000815030 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000141302 protein_coding No analysis available: incomplete transcript
ENSMUST00000149273 protein_coding No analysis available: incomplete transcript
ENSMUST00000133848 retained_intron Target region does not overlap transcript
ENSMUST00000141527 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0623_2_B04 HTGRS6014_A_A02 Mtss1ltm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0623_2_B03 HTGRS6014_A_A02 Mtss1ltm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0623_2_D02 HTGRS6014_A_A02 Mtss1ltm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0623_2_D03 HTGRS6014_A_A02 Mtss1ltm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0623_2_E01 HTGRS6014_A_A02 Mtss1ltm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0623_2_E03 HTGRS6014_A_A02 Mtss1ltm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0623_2_F01 HTGRS6014_A_A02 Mtss1ltm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0623_2_G04 HTGRS6014_A_A02 Mtss1ltm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0623_2_A04 HTGRS6014_A_A02 Mtss1ltm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0623_2_H03 HTGRS6014_A_A02 Mtss1ltm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 45789 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06014_A_6_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45789 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06014_A_4_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45789 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06014_A_1_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45789 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06014_A_8_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45789 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06014_A_5_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45789 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06014_A_7_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45789 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06014_A_2_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45789 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06014_A_3_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 45789 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS6014_A_A02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
45789 Knockout-First - Reporter Tagged Insertion PCS6014_A_A02