IKMC Project Report - KOMP-CSD (ID: 79622)

1110038F14Rik MGI:2152337 ENSMUSG00000063236
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000071792 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAPPIRPRYSSSVRPPERRAEGSAGLVLQKEPKPLRT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001089701 CDS CDS
ENSMUSE00000332326 CDS Deleted
ENSMUSE00000480600 CDS Deleted
ENSMUSE00000128107 CDS Deleted
ENSMUSE00000424381 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 213235 Deletion (Promotor Driven Cassette) HTGR06009_A_1_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213235 Deletion (Promotor Driven Cassette) HTGRS06009_A_G09 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213235 Deletion (Promotor Driven Cassette) HTGR06009_A_4_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213235 Deletion (Promotor Driven Cassette) HTGR06009_A_2_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213235 Deletion (Promotor Driven Cassette) HTGR06009_A_3_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213235 Deletion (Promotor Driven Cassette) HTGR06009_A_5_G10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
213235 Deletion PCS6009_A_G09