IKMC Project Report - KOMP-CSD (ID: 79707)

Rrp8 MGI:1914251 ENSMUSG00000030888 OTTMUSG00000025597
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000033179 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MFEEPEWVEAAPAIVGLGAATAQVRPATAPPVKGRKRRHLLATLRALEAASLSQQTPSLPGSDSEEEEEVGRKKRHLQRP
SLASVSKEVGKKRKGKCQKQAPSISDSEGKEIRRKCHRQAPPLGGVSAGEEKGKRKCQEYSSLHLTQPLDSVDQTGPDQQ
PLLLV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000762075 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000204669 CDS CDS
ENSMUSE00000204671 Methyltransferase-rel (68/219 aa) CDS Deleted
ENSMUSE00001094454 Methyltransferase-rel (44/219 aa) | Methyltransf_11 (35/75 aa) CDS Deleted
ENSMUSE00001085007 Methyltransferase-rel (36/219 aa) | Methyltransf_11 (36/75 aa) CDS Deleted
ENSMUSE00001010343 Methyltransferase-rel (33/219 aa) | Methyltransf_11 (5/75 aa) CDS Deleted
ENSMUSE00000837970 Methyltransferase-rel (39/219 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000098148 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSTPSSGERTCSRLTRQRFSSPLIEVVLCVVQPQAHRHRVALPALSENVVHSSVPAQRPRDWGSLGGLRENRDKRMTLCG
RKRRHLLATLRALEAASLSQQTPSLPGSDSEEEEEVGRKKRHLQRPSLASVSKEVGKKRKGKCQKQAPSISDSEGKEIRR
KCHRQAPPLGGVSAGEEKGKRKCQEYSSLHLTQPLDSVDQTGPDQQPLLLV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000632982 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000204669 CDS CDS
ENSMUSE00000204671 Methyltransferase-rel (68/219 aa) CDS Deleted
ENSMUSE00001094454 Methyltransferase-rel (44/219 aa) | Methyltransf_11 (35/75 aa) CDS Deleted
ENSMUSE00001085007 Methyltransferase-rel (36/219 aa) | Methyltransf_11 (36/75 aa) CDS Deleted
ENSMUSE00001010343 Methyltransferase-rel (33/219 aa) | Methyltransf_11 (5/75 aa) CDS Deleted
ENSMUSE00000816113 Methyltransferase-rel (39/219 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000148176 retained_intron No analysis available: incomplete transcript
ENSMUST00000127738 processed_transcript No analysis available: incomplete transcript
ENSMUST00000154852 retained_intron No analysis available: incomplete transcript
ENSMUST00000137902 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones Without Conditional Potential (Deletions)

Note: Mutations of type "Deletion" are correctly targeted clones that have had the target exon removed. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0719_4_F05 HTGRS06009_A_G07 Rrp8tm1(EUCOMM)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0719_4_B05 HTGRS06009_A_G07 Rrp8tm1(EUCOMM)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0719_4_B06 HTGRS06009_A_G07 Rrp8tm1(EUCOMM)Wtsi Deletion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 213200 Deletion (Promotor Driven Cassette) HTGR06009_A_7_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213200 Deletion (Promotor Driven Cassette) HTGR06009_A_1_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213200 Deletion (Promotor Driven Cassette) HTGR06009_A_4_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213200 Deletion (Promotor Driven Cassette) HTGR06009_A_2_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 213200 Deletion (Promotor Driven Cassette) HTGRS06009_A_G07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
213200 Deletion PCS6009_A_G07