IKMC Project Report - KOMP-CSD (ID: 79925)

Brwd1 MGI:1890651 ENSMUSG00000022914 OTTMUSG00000020395
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 16 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000023631 protein_coding No protein product (NMD) view

Predicted translation: 

MAEPSPARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQ
ICQRIGPMLDKEVPPSISRVTSLLGAGRQSLLRTAKDCRHTVWKGSAFAALHRGRPPEMPVNYGPPPSLVEIHRGRQLTG
CSTFSTAFPGTMYQHIKMHRRILGHLSAVYCVAFDRTGHRIFTGSDDCLVKIWSTHNGRLLSTLRGHSAEISDMAVNYEN
TLIAAGSCDKIIRVWCLRTCAPVAVLQGHTGSITSLQSTTPEVHGKAKAWCSDAVFFI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000697114 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000262593 CDS CDS
ENSMUSE00000511630 CDS CDS
ENSMUSE00000131887 CDS CDS
ENSMUSE00000417300 CDS CDS
ENSMUSE00000417292 CDS CDS
ENSMUSE00000417288 WD40_repeat (21/33 aa) CDS CDS
ENSMUSE00000554894 WD40_repeat (12/33 aa) | WD40_repeat (37/37 aa) | WD40_repeat (15/40 aa) CDS CDS
ENSMUSE00000417283 WD40_repeat (25/40 aa) CDS Deleted
ENSMUSE00000417275 WD40_repeat (22/39 aa) CDS CDS + stop codon + UTR
ENSMUSE00000297165 WD40_repeat (18/39 aa) | WD40_repeat (8/36 aa) CDS
ENSMUSE00000554881 WD40_repeat (14/36 aa) CDS
ENSMUSE00000417256 WD40_repeat (15/36 aa) CDS
ENSMUSE00000417251 WD40_repeat (26/26 aa) | WD40_repeat (7/40 aa) CDS
ENSMUSE00000417245 WD40_repeat (33/40 aa) CDS
ENSMUSE00000554869 WD40_repeat (21/21 aa) CDS
ENSMUSE00001038418 CDS
ENSMUSE00000131895 CDS
ENSMUSE00000262475 CDS
ENSMUSE00000973941 CDS
ENSMUSE00000965992 CDS
ENSMUSE00001081737 CDS
ENSMUSE00000978750 CDS
ENSMUSE00000262459 CDS
ENSMUSE00000262455 CDS
ENSMUSE00000262450 CDS
ENSMUSE00000262443 CDS
ENSMUSE00000262438 CDS
ENSMUSE00000262434 CDS
ENSMUSE00000262430 Bromodomain (14/87 aa) CDS
ENSMUSE00000262425 Bromodomain (41/87 aa) CDS
ENSMUSE00001043913 Bromodomain (34/87 aa) CDS
ENSMUSE00001081287 CDS
ENSMUSE00001074446 CDS
ENSMUSE00001072625 Bromodomain (19/74 aa) CDS
ENSMUSE00001064229 Bromodomain (51/74 aa) CDS
ENSMUSE00000973948 Bromodomain (4/74 aa) CDS
ENSMUSE00001001815 CDS
ENSMUSE00001080532 CDS
ENSMUSE00000977086 CDS
ENSMUSE00000430335 CDS
ENSMUSE00000554805 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000113827 protein_coding Target region does not overlap transcript
ENSMUST00000153398 protein_coding No analysis available: incomplete transcript
ENSMUST00000099502 protein_coding No protein product (NMD) view

Predicted translation: 

MAEPSPARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQ
ICQRIGPMLDKEVPPSISRVTSLLGAGRQSLLRTAKDCRHTVWKGSAFAALHRGRPPEMPVNYGPPPSLVEIHRGRQLTG
CSTFSTAFPGTMYQHIKMHRRILGHLSAVYCVAFDRTGHRIFTGSDDCLVKIWSTHNGRLLSTLRGHSAEISDMAVNYEN
TLIAAGSCDKIIRVWCLRTCAPVAVLQGHTGSITSLQSTTPEVHGKAKAWCSDAVFFI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000641934 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000262593 CDS CDS
ENSMUSE00000511630 CDS CDS
ENSMUSE00000131887 CDS CDS
ENSMUSE00000417300 CDS CDS
ENSMUSE00000417292 CDS CDS
ENSMUSE00000417288 WD40_repeat (21/33 aa) CDS CDS
ENSMUSE00000554894 WD40_repeat (12/33 aa) | WD40_repeat (37/37 aa) | WD40_repeat (15/40 aa) CDS CDS
ENSMUSE00000417283 WD40_repeat (25/40 aa) CDS Deleted
ENSMUSE00000417275 WD40_repeat (22/39 aa) CDS CDS + stop codon + UTR
ENSMUSE00000297165 WD40_repeat (18/39 aa) | WD40_repeat (8/36 aa) CDS
ENSMUSE00000554881 WD40_repeat (14/36 aa) CDS
ENSMUSE00000417256 WD40_repeat (15/36 aa) CDS
ENSMUSE00000417251 WD40_repeat (26/26 aa) | WD40_repeat (7/40 aa) CDS
ENSMUSE00000417245 WD40_repeat (33/40 aa) CDS
ENSMUSE00000554869 WD40_repeat (21/21 aa) CDS
ENSMUSE00001038418 CDS
ENSMUSE00000131895 CDS
ENSMUSE00000262475 CDS
ENSMUSE00000973941 CDS
ENSMUSE00000965992 CDS
ENSMUSE00001081737 CDS
ENSMUSE00000978750 CDS
ENSMUSE00000262459 CDS
ENSMUSE00000262455 CDS
ENSMUSE00000262450 CDS
ENSMUSE00000262443 CDS
ENSMUSE00000262438 CDS
ENSMUSE00000262434 CDS
ENSMUSE00000262430 Bromodomain (14/87 aa) CDS
ENSMUSE00000262425 Bromodomain (41/87 aa) CDS
ENSMUSE00001043913 Bromodomain (34/87 aa) CDS
ENSMUSE00001081287 CDS
ENSMUSE00001074446 CDS
ENSMUSE00001072625 Bromodomain (19/74 aa) CDS
ENSMUSE00001064229 Bromodomain (51/74 aa) CDS
ENSMUSE00000973948 Bromodomain (4/74 aa) CDS
ENSMUSE00001001815 CDS
ENSMUSE00001030482 CDS
ENSMUSE00001058995 CDS
ENSMUSE00000430335 CDS
ENSMUSE00000886905 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000113829 protein_coding No protein product (NMD) view

Predicted translation: 

MAEPSPARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQ
ICQRIGPMLDKEVPPSISRVTSLLGAGRQSLLRTAKDCRHTVWKGSAFAALHRGRPPEMPVNYGPPPSLVEIHRGRQLTG
CSTFSTAFPGTMYQHIKMHRRILGHLSAVYCVAFDRTGHRIFTGSDDCLVKIWSTHNGRLLSTLRGHSAEISDMAVNYEN
TLIAAGSCDKIIRVWCLRTCAPVAVLQGHTGSITSLQSTTPEVHGKAKAWCSDAVFFI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000697114 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000262593 CDS CDS
ENSMUSE00000511630 CDS CDS
ENSMUSE00000131887 CDS CDS
ENSMUSE00000417300 CDS CDS
ENSMUSE00000417292 CDS CDS
ENSMUSE00000417288 WD40_repeat (21/33 aa) CDS CDS
ENSMUSE00000554894 WD40_repeat (12/33 aa) | WD40_repeat (37/37 aa) | WD40_repeat (15/40 aa) CDS CDS
ENSMUSE00000417283 WD40_repeat (25/40 aa) CDS Deleted
ENSMUSE00000417275 WD40_repeat (22/39 aa) CDS CDS + stop codon + UTR
ENSMUSE00000297165 WD40_repeat (18/39 aa) | WD40_repeat (8/36 aa) CDS
ENSMUSE00000554881 WD40_repeat (14/36 aa) CDS
ENSMUSE00000417256 WD40_repeat (15/36 aa) CDS
ENSMUSE00000417251 WD40_repeat (26/26 aa) | WD40_repeat (7/40 aa) CDS
ENSMUSE00000417245 WD40_repeat (33/40 aa) CDS
ENSMUSE00000554869 WD40_repeat (21/21 aa) CDS
ENSMUSE00001038418 CDS
ENSMUSE00000131895 CDS
ENSMUSE00000262475 CDS
ENSMUSE00000973941 CDS
ENSMUSE00000965992 CDS
ENSMUSE00001081737 CDS
ENSMUSE00000978750 CDS
ENSMUSE00000262459 CDS
ENSMUSE00000262455 CDS
ENSMUSE00000262450 CDS
ENSMUSE00000262443 CDS
ENSMUSE00000262438 CDS
ENSMUSE00000262434 CDS
ENSMUSE00000262430 Bromodomain (14/87 aa) CDS
ENSMUSE00000262425 Bromodomain (41/87 aa) CDS
ENSMUSE00001043913 Bromodomain (34/87 aa) CDS
ENSMUSE00001081287 CDS
ENSMUSE00001074446 CDS
ENSMUSE00001072625 Bromodomain (19/74 aa) CDS
ENSMUSE00001064229 Bromodomain (51/74 aa) CDS
ENSMUSE00000973948 Bromodomain (4/74 aa) CDS
ENSMUSE00001001815 CDS
ENSMUSE00001080532 CDS
ENSMUSE00000977086 CDS
ENSMUSE00000697113 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000124370 protein_coding No analysis available: incomplete transcript
ENSMUST00000152197 protein_coding Target region does not overlap transcript
ENSMUST00000131322 nonsense_mediated_decay Target region does not overlap transcript
ENSMUST00000139566 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000157037 retained_intron Target region does not overlap transcript
ENSMUST00000148432 retained_intron Target region does not overlap transcript
ENSMUST00000156622 processed_transcript Target region does not overlap transcript
ENSMUST00000126629 retained_intron Target region does not overlap transcript
ENSMUST00000127777 retained_intron Target region does not overlap transcript
ENSMUST00000147655 retained_intron Target region does not overlap transcript
ENSMUST00000130823 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0859_1_A10 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_H10 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_A12 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_E11 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_A11 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_G10 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_E12 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_D10 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_G11 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_F10 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_H12 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_H11 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_F11 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0859_1_C09 HTGR06008_A_2_H06 Brwd1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 188383 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06008_A_2_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 188383 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06008_A_3_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 188383 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS6008_A_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 188383 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06008_A_6_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 188383 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06008_A_5_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 188383 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06008_A_7_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 188383 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06008_A_8_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 188383 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06008_A_1_H06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
188383 Knockout-First - Reporter Tagged Insertion PCS6008_A_H06