IKMC Project Report - KOMP-CSD (ID: 79990)

Slc25a54 MGI:1921936 ENSMUSG00000027880 OTTMUSG00000007309
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000029478 protein_coding No protein product (NMD) view

Predicted translation: 

MLRRLQDFLLPSEACQNDYNRLAYEVLFEDLDHNGDGVVDITELRDGLKHWNSSFSEDTEKA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000173886 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000173888 CDS Deleted
ENSMUSE00001057334 CDS CDS + stop codon + UTR
ENSMUSE00001090712 CDS
ENSMUSE00000273311 Mitochondrial_sb/sol_carrier (30/88 aa) CDS
ENSMUSE00000273305 Mitochondrial_sb/sol_carrier (51/88 aa) CDS
ENSMUSE00000273296 Mitochondrial_sb/sol_carrier (7/88 aa) | Mitochondrial_sb/sol_carrier (25/89 aa) CDS
ENSMUSE00000273291 Mitochondrial_sb/sol_carrier (56/89 aa) CDS
ENSMUSE00000173876 Mitochondrial_sb/sol_carrier (8/89 aa) | Mitochondrial_sb/sol_carrier (28/83 aa) CDS
ENSMUSE00000173880 Mitochondrial_sb/sol_carrier (56/83 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000159926 protein_coding Design floxes no exons in transcript ENSMUST00000159926
show/hide more transcripts

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0861_1_C10 HTGRS6011_A_A12 Slc25a54tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 35811 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS6011_A_A12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 35811 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_8_A12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 35811 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_1_A12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 35811 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_7_A12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 35811 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_2_A12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 35811 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_3_A12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 35811 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_5_A12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
35811 Knockout-First - Reporter Tagged Insertion PCS6011_A_A12