IKMC Project Report - KOMP-CSD (ID: 80151)

Melk MGI:106924 ENSMUSG00000035683 OTTMUSG00000006665
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000045607 protein_coding Residual C-terminal product view

Predicted translation: 

MTNSSNTMNYMKRLGQSDLPRVKTEIDALKSLRHQHICQLYHVLETKNKIFMVLEYCPGGELFDYIISQDRLSEEETRVV
FRQILSAVAYVHSQGYAHRDLKPENLLFDENHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADV
WSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYEVPKWLSPSSILLLQQMLQVDPKKRISMRNLLNHPWVMQDYSCPVE
WQSKTPLTHLDEDCVTELSVHHRSSRQTMEDLISSWQYDHLTATYLLLLAKKARGKPARLQLLSFSCGTASTTPKSKNLS
LEDMSTSDDNCVAGLIDYELCEDKLLAPKTPQVTKHLAESNHAASKSPAPGVRRAVANKLMDKENVCTPKSSVKNEEQFV
FSEPKIPVSKNQYKREIPASPTRFPTPAKARAQCLREAPVRTPGNSAGADTLTTGVISPERRCRSMDVDLNQAHMEDTPK
KKGTNVFGSLERGLDKVLTALTRNKKKGSARDGPRKRKLHYNVTTTRLVNPDQLLSEIMAILPKKNVDFVQKGYTLKCQT
QSDFGKVTMQFELEVCQLQRPDVVGIRRQRLKGDAWVYKRLVEDILSGCKM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000746079 UTR UTR
ENSMUSE00000286803 Prot_kinase_cat_dom (9/253 aa) | Ser-Thr/Tyr_kinase_cat_dom (8/248 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000286795 Prot_kinase_cat_dom (29/253 aa) | Ser-Thr/Tyr_kinase_cat_dom (29/248 aa) CDS Deleted
ENSMUSE00001023760 Prot_kinase_cat_dom (39/253 aa) | Ser-Thr/Tyr_kinase_cat_dom (39/248 aa) CDS CDS
ENSMUSE00000286772 Prot_kinase_cat_dom (48/253 aa) | Ser-Thr/Tyr_kinase_cat_dom (48/248 aa) | LipoPS_kinase (41/65 aa) CDS CDS
ENSMUSE00001040328 Prot_kinase_cat_dom (23/253 aa) | Ser-Thr/Tyr_kinase_cat_dom (23/248 aa) | LipoPS_kinase (23/65 aa) CDS CDS
ENSMUSE00001074958 Prot_kinase_cat_dom (31/253 aa) | Ser-Thr/Tyr_kinase_cat_dom (31/248 aa) | LipoPS_kinase (1/65 aa) CDS CDS
ENSMUSE00001013241 Prot_kinase_cat_dom (33/253 aa) | Ser-Thr/Tyr_kinase_cat_dom (33/248 aa) CDS CDS
ENSMUSE00001054352 Prot_kinase_cat_dom (23/253 aa) | Ser-Thr/Tyr_kinase_cat_dom (23/248 aa) CDS CDS
ENSMUSE00000911680 Prot_kinase_cat_dom (19/253 aa) | Ser-Thr/Tyr_kinase_cat_dom (15/248 aa) CDS CDS
ENSMUSE00000286730 CDS CDS
ENSMUSE00000660800 CDS CDS
ENSMUSE00000660799 CDS CDS
ENSMUSE00000286714 CDS CDS
ENSMUSE00000286705 CDS CDS
ENSMUSE00000286695 CDS CDS
ENSMUSE00000286686 CDS CDS
ENSMUSE00000286680 Kinase-assoc_KA1 (45/45 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000137703 protein_coding No analysis available: incomplete transcript
ENSMUST00000125708 protein_coding No analysis available: incomplete transcript
ENSMUST00000137759 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 36022 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_7_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 36022 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_4_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 36022 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_8_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 36022 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_5_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 36022 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_3_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 36022 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_2_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 36022 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGRS6011_A_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 36022 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_6_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 36022 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR06011_A_1_F07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
36022 Knockout-First - Reporter Tagged Insertion PCS6011_A_F07