IKMC Project Report - EUCOMM (ID: 81259)

Esr1 MGI:1352467 ENSMUSG00000019768 OTTMUSG00000020886
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000067086 protein_coding No protein product (NMD) view

Predicted translation: 

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQS
GIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRTQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000791598 UTR UTR
ENSMUSE00001004552 Oestr_rcpt (113/144 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001019354 Oestr_rcpt (32/144 aa) | Znf_hrmn_rcpt (31/69 aa) CDS Deleted
ENSMUSE00001013742 Znf_hrmn_rcpt (39/69 aa) CDS CDS + stop codon + UTR
ENSMUSE00001015889 CDS
ENSMUSE00001070826 Nucl_hrmn_rcpt_lig-bd_core (38/170 aa) CDS
ENSMUSE00000980535 Nucl_hrmn_rcpt_lig-bd_core (46/170 aa) CDS
ENSMUSE00001085607 Nucl_hrmn_rcpt_lig-bd_core (62/170 aa) CDS
ENSMUSE00000463962 Nucl_hrmn_rcpt_lig-bd_core (27/170 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000105589 protein_coding No protein product (NMD) view

Predicted translation: 

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQS
GIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRTQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000666824 UTR UTR
ENSMUSE00001004552 Oestr_rcpt (113/144 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001019354 Oestr_rcpt (32/144 aa) | Znf_hrmn_rcpt (31/69 aa) CDS Deleted
ENSMUSE00001013742 Znf_hrmn_rcpt (39/69 aa) CDS CDS + stop codon + UTR
ENSMUSE00001015889 CDS
ENSMUSE00001070826 Nucl_hrmn_rcpt_lig-bd_core (38/170 aa) CDS
ENSMUSE00000980535 Nucl_hrmn_rcpt_lig-bd_core (46/170 aa) CDS
ENSMUSE00001085607 Nucl_hrmn_rcpt_lig-bd_core (62/170 aa) CDS
ENSMUSE00000666823 Nucl_hrmn_rcpt_lig-bd_core (27/170 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000105590 protein_coding No protein product (NMD) view

Predicted translation: 

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQS
GIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRTQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000666827 UTR UTR
ENSMUSE00000666826 UTR UTR
ENSMUSE00001004552 Oestr_rcpt (113/144 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001019354 Oestr_rcpt (32/144 aa) | Znf_hrmn_rcpt (31/69 aa) CDS Deleted
ENSMUSE00001013742 Znf_hrmn_rcpt (39/69 aa) CDS CDS + stop codon + UTR
ENSMUSE00001015889 CDS
ENSMUSE00001070826 Nucl_hrmn_rcpt_lig-bd_core (38/170 aa) CDS
ENSMUSE00000980535 Nucl_hrmn_rcpt_lig-bd_core (46/170 aa) CDS
ENSMUSE00001085607 Nucl_hrmn_rcpt_lig-bd_core (62/170 aa) CDS
ENSMUSE00000666825 Nucl_hrmn_rcpt_lig-bd_core (27/170 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000105588 protein_coding No protein product (NMD) view

Predicted translation: 

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQS
GIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRTQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000666824 UTR UTR
ENSMUSE00001004552 Oestr_rcpt (113/144 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001019354 Oestr_rcpt (32/144 aa) | Znf_hrmn_rcpt (31/69 aa) CDS Deleted
ENSMUSE00001013742 Znf_hrmn_rcpt (39/69 aa) CDS CDS + stop codon + UTR
ENSMUSE00001015889 CDS
ENSMUSE00001070826 Nucl_hrmn_rcpt_lig-bd_core (38/42 aa) CDS
ENSMUSE00000666822 Nucl_hrmn_rcpt_lig-bd_core (5/42 aa) CDS
ENSMUSE00000666821 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000149195 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000133985 retained_intron Target region does not overlap transcript
ENSMUST00000138828 retained_intron No analysis available: incomplete transcript
ENSMUST00000127145 processed_transcript No analysis available: incomplete transcript
ENSMUST00000137012 processed_transcript Target region does not overlap transcript
ENSMUST00000127934 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0730_3_C08 PG00228_Z_3_F04 Esr1tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_F04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_E12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_D06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_C03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_E09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_B01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_D01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_A05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_F07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_B10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_H02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_E04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_E11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_B02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 296592 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00228_Z_3_D05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
296592 Knockout First, Reporter-tagged insertion with conditional potential PCS00228_A_C05