IKMC Project Report - EUCOMM (ID: 81291)

2610301G19Rik MGI:2444228 ENSMUSG00000033712
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000035612 protein_coding No protein product (NMD) view

Predicted translation: 

MSQFKRQRINPLPGGRNFSGAASTSLLGPPPGLLTPPVATDLSQNARHLQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000263296 UTR UTR
ENSMUSE00000263281 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000263273 CDS CDS
ENSMUSE00000263268 CDS Deleted
ENSMUSE00000263262 CDS Deleted
ENSMUSE00000263253 CDS Deleted
ENSMUSE00000263247 CDS Deleted
ENSMUSE00000263242 CDS CDS + stop codon + UTR
ENSMUSE00000263235 CDS
ENSMUSE00000263227 CDS
ENSMUSE00000263220 CDS
ENSMUSE00000263211 CDS
ENSMUSE00000263203 CDS
ENSMUSE00000263193 CDS
ENSMUSE00000263183 CDS
ENSMUSE00000263177 CDS
ENSMUSE00000263164 CDS
ENSMUSE00000263156 CDS
ENSMUSE00000263144 CDS
ENSMUSE00000263135 CDS
ENSMUSE00000384421 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0728_2_E07 PG00227_Z_1_E02 2610301G19Riktm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0728_2_G05 PG00227_Z_1_E02 2610301G19Riktm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_H02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_G08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_A10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_G01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_A11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_A09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_H12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_G07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_H11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_E10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_G05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_H03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_D11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_B10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_B12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_F07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_C07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_F06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_H05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_E12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_F08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_D02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_A06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_A07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_D03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_A04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_H10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_G12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_E02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 295676 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00227_Z_1_E08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
295676 Knockout-First - Reporter Tagged Insertion PCS00227_A_A02