IKMC Project Report - EUCOMM (ID: 81430)

Kank1 MGI:2147707 ENSMUSG00000032702 OTTMUSG00000033447
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000049400 protein_coding Residual N-terminal, residual C-terminal product view

Predicted translation: 

MAYTTKVNGCAAGNHLEYTCKCGGLRSGGLLNVQPSQPEVEAETAEGKHSRGHEQFPMQGSTLPPVNLTDDQIATGLYVC
PNNENTLKSIMKKSDGNKDSNGAKKNLQFIGINGGYETTSSDESSSDGSSSSESDDECDTIGYPPEEEEEEEEKDHDTRG
MAEGHHAVNIEGFKSARVEDEVQVPECEPEKEEIRERYELSEKMLSACNLLKYNIKDPKALASKDMRICLNTLQHDWFRV
SSQKSAVPAMVGDYIAAFEAVSPDVLRYIINMADGNGNTALHYSVSHSNFQIVKLLLDADVCNVDHQNKAGYTPIMLAAL
AAVEAEKDMQVVEELFSCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKL
LLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHLNFSKAQSPSTPRLGRKTSPGPTHRGSFD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000833617 UTR UTR
ENSMUSE00000692603 UTR UTR
ENSMUSE00000692600 UTR UTR
ENSMUSE00000910049 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000262621 KN_motif (39/39 aa) CDS Deleted
ENSMUSE00000262596 CDS CDS
ENSMUSE00001089737 CDS CDS
ENSMUSE00000262569 CDS CDS
ENSMUSE00000972920 CDS CDS
ENSMUSE00000262765 Ankyrin_rpt (24/30 aa) CDS CDS
ENSMUSE00000262742 Ankyrin_rpt (7/30 aa) CDS CDS
ENSMUSE00000262718 Ankyrin_rpt (32/32 aa) | Ankyrin_rpt (23/23 aa) CDS CDS
ENSMUSE00000262520 CDS CDS
ENSMUSE00000361670 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000146647 protein_coding No analysis available: incomplete transcript
ENSMUST00000137260 processed_transcript No analysis available: incomplete transcript
ENSMUST00000155788 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0745_4_D06 HTGR04008_Z_5_B08 Kank1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0745_4_E08 HTGR04008_Z_5_B08 Kank1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0745_4_F08 HTGR04008_Z_5_B08 Kank1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0745_4_F07 HTGR04008_Z_5_B08 Kank1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_H01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_C05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_A01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_G02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_B04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_G03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_H02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_C07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_F01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_B10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 108902 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR04008_Z_5_B08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
108902 Knockout First, Reporter-tagged insertion with conditional potential PCS04008_A_E03