IKMC Project Report - EUCOMM (ID: 81448)

2410137M14Rik MGI:1924047 ENSMUSG00000064308 OTTMUSG00000014935
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000039846 protein_coding Novel C-terminal product view

Predicted translation:

MLTLLFLSFYLHPLTSSPSTESLERKQRPSPSLILLNNPAAGHSLSPWLHCGGSPVSCIGSGGVWLLYSVPGYEGSSLEF
WIFLRLKKKSVRL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000696618 UTR + start codon + CDS
ENSMUSE00000495553 Ig_C1-set (78/78 aa) CDS Deleted
ENSMUSE00000142479 CDS Deleted
ENSMUSE00000657352 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000173707 protein_coding Novel C-terminal product view

Predicted translation:

MLTLLFLSFYLHPLTSSPSTESLERKQRPSPSLILLNNPAAGHSLSPWLH

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000930141 UTR + start codon + CDS
ENSMUSE00000495553 Ig_C1-set (78/78 aa) CDS Deleted
ENSMUSE00000937807 CDS + stop codon + UTR Deleted
ENSMUSE00000927741 UTR UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 115589 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04008_Z_6_E06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
115589 Knockout-First - Reporter Tagged Insertion PCS04008_A_F10