IKMC Project Report - KOMP-CSD (ID: 81558)

Pcdh1 MGI:104692 ENSMUSG00000051375 OTTMUSG00000033463
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000057185 protein_coding No protein product
ENSMUST00000159405 protein_coding No protein product
ENSMUST00000160721 protein_coding No protein product (NMD) view

Predicted translation: 

MTVAWRNRKHPLASHPPAPGLVPWLFLRTTMSVPPLTAA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000856323 UTR UTR
ENSMUSE00000509165 Cadherin (97/97 aa) | Cadherin_N (82/82 aa) UTR + start codon + CDS Deleted
ENSMUSE00000703529 CDS
ENSMUSE00000860735 CDS + stop codon + UTR
ENSMUSE00000871010 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000161701 protein_coding No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 199192 Deletion (Promotor Driven Cassette) DPG00207_Z_2_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199192 Deletion (Promotor Driven Cassette) DPG00207_Z_8_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199192 Deletion (Promotor Driven Cassette) DPG00207_Z_7_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199192 Deletion (Promotor Driven Cassette) DPG00207_Z_6_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199192 Deletion (Promotor Driven Cassette) DPG00207_Z_4_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199192 Deletion (Promotor Driven Cassette) DPG00207_Z_1_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199192 Deletion (Promotor Driven Cassette) DPG00207_Z_3_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199192 Deletion (Promotor Driven Cassette) DPGS00207_A_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 199192 Deletion (Promotor Driven Cassette) DPG00207_Z_5_G08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
199192 Deletion PCTS00207_A_G08