IKMC Project Report - KOMP-CSD (ID: 82125)

Acat2 MGI:87871 ENSMUSG00000023832 OTTMUSG00000028085
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000007005 protein_coding No protein product (NMD) view

Predicted translation:

MNAGSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIP
YSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKLKT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000437372 Thiolase_N (12/260 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001086036 Thiolase_N (46/260 aa) CDS CDS
ENSMUSE00001046038 Thiolase_N (61/260 aa) CDS CDS
ENSMUSE00001091223 Thiolase_N (40/260 aa) CDS Deleted
ENSMUSE00000991427 Thiolase_N (49/260 aa) CDS CDS + stop codon + UTR
ENSMUSE00001034481 Thiolase_N (42/260 aa) CDS
ENSMUSE00001019123 Thiolase_N (15/260 aa) | Thiolase_C (30/123 aa) CDS
ENSMUSE00000989558 Thiolase_C (37/123 aa) CDS
ENSMUSE00000658296 Thiolase_C (56/123 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000159697 protein_coding No protein product (NMD) view

Predicted translation:

MGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDST
IVVAGGMENMSKLKT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000856330 Thiolase_N (31/234 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001046038 Thiolase_N (61/234 aa) CDS CDS
ENSMUSE00001091223 Thiolase_N (40/234 aa) CDS Deleted
ENSMUSE00000991427 Thiolase_N (49/234 aa) CDS CDS + stop codon + UTR
ENSMUSE00001034481 Thiolase_N (42/234 aa) CDS
ENSMUSE00001019123 Thiolase_N (15/234 aa) | Thiolase_C (30/123 aa) CDS
ENSMUSE00000989558 Thiolase_C (37/123 aa) | ACP_syn_III_C (35/88 aa) CDS
ENSMUSE00000854190 Thiolase_C (56/123 aa) | ACP_syn_III_C (53/88 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000159358 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 95021 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00209_A_D12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 95021 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00209_Z_3_D12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 95021 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00209_Z_4_D12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 95021 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00209_Z_8_D12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 95021 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00209_Z_1_D12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 95021 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00209_Z_7_D12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 95021 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00209_Z_6_D12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 95021 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00209_Z_2_D12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
95021 Knockout First, Reporter-tagged insertion with conditional potential PCS00209_A_D12