IKMC Project Report - KOMP-CSD (ID: 82125)
Acat2 MGI:87871 ENSMUSG00000023832 OTTMUSG00000028085
Mice no data available
Mutagenesis Predictions
This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000007005 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MNAGSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIP YSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKLKT*
|
||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000159697 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDST IVVAGGMENMSKLKT*
|
||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000159358 | processed_transcript | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones no data available
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 95021 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PRPGS00209_A_D12 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 95021 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00209_Z_3_D12 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 95021 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00209_Z_4_D12 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 95021 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00209_Z_8_D12 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 95021 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00209_Z_1_D12 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 95021 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00209_Z_7_D12 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 95021 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00209_Z_6_D12 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
| order | 95021 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | PG00209_Z_2_D12 | L1L2_Bact_P | R3R4_pBR_DTA+_Bsd_amp | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 95021 | Knockout First, Reporter-tagged insertion with conditional potential | PCS00209_A_D12 |