IKMC Project Report - KOMP-CSD (ID: 82340)

Acnat1 MGI:2140197 ENSMUSG00000070985 OTTMUSG00000008317
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000095086 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MMIKLIATPSNALVDEPVSIRATGLPPSQIVTIKATVKDENDNVFQSQAFYKTNEAGEVDLEKTPALGGDYVGVHPMGLF
FSLKPKKAFHRLMKKDVMNSPFCICLDLYDSVNWLETVRIPSKASQRVQRWFVGPGVKREQIQEGRVRGALFLPPDPTAR
NWCDLHEQRSRDWASYGLLPEAGDCHGLHKWGHHHHSRPTKIPGSGCDTHPTGSGTDGGPCFRGCMLPSHYTISPE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000604596 Thio_Ohase/aa_AcTrfase (132/132 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001006188 BAAT_C (17/205 aa) | Serine_hydrolase_FSH (19/153 aa) CDS Deleted
ENSMUSE00000604594 BAAT_C (188/205 aa) | Serine_hydrolase_FSH (134/153 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000107697 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MMIKLIATPSNALVDEPVSIRATGLPPSQIVTIKATVKDENDNVFQSQAFYKTNEAGEVDLEKTPALGGDYVGVHPMGLF
FSLKPKKAFHRLMKKDVMNSPFCICLDLYDSVNWLETVRIPSKASQRVQRWFVGPGVKREQIQEGRVRGALFLPPDPTAR
NWCDLHEQRSRDWASYGLLPEAGDCHGLHKWGHHHHSRPTKIPGSGCDTHPTGSGTDGGPCFRGCMLPSHYTISPE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000971263 Thio_Ohase/aa_AcTrfase (132/132 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001030890 BAAT_C (17/205 aa) | Serine_hydrolase_FSH (19/153 aa) CDS Deleted
ENSMUSE00000674158 BAAT_C (188/205 aa) | Serine_hydrolase_FSH (134/153 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000135976 protein_coding Target region does not overlap transcript
ENSMUST00000150392 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 212973 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00211_Z_3_A03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 212973 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00211_Z_1_A03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 212973 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00211_Z_8_A03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 212973 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00211_A_A03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
212973 Knockout First, Reporter-tagged insertion with conditional potential PCTS00211_A_A03