IKMC Project Report - EUCOMM (ID: 82592)

N6amt1 MGI:1915018 ENSMUSG00000044442 OTTMUSG00000026535
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000054442 protein_coding No protein product (NMD) view

Predicted translation: 

MAAPSVPTPLYGHVGRGAFRDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGAGSGVVSAFLASMIGPRALYMCTACCP
D*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000480914 Small_mtfrase_dom (16/157 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000479699 Small_mtfrase_dom (30/157 aa) CDS CDS
ENSMUSE00000478890 Small_mtfrase_dom (31/157 aa) CDS Deleted
ENSMUSE00000478117 Small_mtfrase_dom (28/157 aa) CDS CDS + stop codon + UTR
ENSMUSE00000400999 Small_mtfrase_dom (48/157 aa) CDS
ENSMUSE00001049470 Small_mtfrase_dom (7/157 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000118310 protein_coding No protein product (NMD) view

Predicted translation: 

MAAPSVPTPLYGHVGRGAFRDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGAGSGVVSAFLASMIGPRALYMCTACCP
D*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000719909 Small_mtfrase_dom (16/97 aa) | Ribosomal-L11_MeTrfase_PrmA (16/94 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000479699 Small_mtfrase_dom (30/97 aa) | Ribosomal-L11_MeTrfase_PrmA (30/94 aa) CDS CDS
ENSMUSE00000478890 Small_mtfrase_dom (31/97 aa) | Ribosomal-L11_MeTrfase_PrmA (31/94 aa) CDS Deleted
ENSMUSE00000478117 Small_mtfrase_dom (22/97 aa) | Ribosomal-L11_MeTrfase_PrmA (19/94 aa) CDS CDS + stop codon + UTR
ENSMUSE00001049746 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000118115 protein_coding No protein product (NMD) view

Predicted translation: 

MAAPSVPTPLYGHVGRGAFRDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGAGSGVVSAFLASMIGPRALYMCTACCP
D*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000715562 Small_mtfrase_dom (16/147 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000479699 Small_mtfrase_dom (30/147 aa) CDS CDS
ENSMUSE00000478890 Small_mtfrase_dom (31/147 aa) CDS Deleted
ENSMUSE00000478117 Small_mtfrase_dom (28/147 aa) CDS CDS + stop codon + UTR
ENSMUSE00000709509 Small_mtfrase_dom (44/147 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000120284 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MAAPSVPTPLYGHVGRGAFRDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGAGSGVVSAFLASMIGPRALYMCTACCP
D*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000721999 Small_mtfrase_dom (16/99 aa) | Ribosomal-L11_MeTrfase_PrmA (16/94 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000479699 Small_mtfrase_dom (30/99 aa) | Ribosomal-L11_MeTrfase_PrmA (30/94 aa) CDS CDS
ENSMUSE00000478890 Small_mtfrase_dom (31/99 aa) | Ribosomal-L11_MeTrfase_PrmA (31/94 aa) CDS Deleted
ENSMUSE00000714333 Small_mtfrase_dom (24/99 aa) | Ribosomal-L11_MeTrfase_PrmA (19/94 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0679_4_C12 PG00213_Z_2_A08 N6amt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0679_4_A10 PG00213_Z_2_A08 N6amt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0679_4_D09 PG00213_Z_2_A08 N6amt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0679_4_H09 PG00213_Z_2_A08 N6amt1tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0679_4_G10 PG00213_Z_2_A08 N6amt1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0679_4_B09 PG00213_Z_2_A08 N6amt1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0679_4_F12 PG00213_Z_2_A08 N6amt1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0679_4_H12 PG00213_Z_2_A08 N6amt1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0679_4_A11 PG00213_Z_2_A08 N6amt1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0679_5_C12 PG00213_Z_2_A08 N6amt1tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_E10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_G03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_F11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_H03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_A03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_H01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_C02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_A06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_G07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_G06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_F07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_G09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_G02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_A04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_A08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 44949 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00213_Z_2_E04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
44949 Knockout First, Reporter-tagged insertion with conditional potential PCS00213_B_B07