IKMC Project Report - EUCOMM (ID: 82726)

Nxf1 MGI:1858330 ENSMUSG00000010097
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000010241 protein_coding No protein product (NMD) view

Predicted translation: 

MADEGKSYNEHDDRVSFPQRRKKGRGPFRWKCGEGNRRSGRGGSGVQSSRFEEDDGDVAMNDPQDGPRVRYNPYTNRPNR
RGDGWHDRDRIHITVRRDRAPAERGGAGTSQDGTTKNWFKITRHSRTISQVITPGWP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000404365 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000144032 CDS CDS
ENSMUSE00000144033 Tap_RNA-bd (10/88 aa) CDS CDS
ENSMUSE00000144047 Tap_RNA-bd (28/88 aa) CDS Deleted
ENSMUSE00000144049 Tap_RNA-bd (35/88 aa) CDS Deleted
ENSMUSE00000144031 Tap_RNA-bd (15/88 aa) CDS Deleted
ENSMUSE00000234704 CDS Deleted
ENSMUSE00000144038 CDS Deleted
ENSMUSE00000144037 CDS Deleted
ENSMUSE00000144043 CDS Deleted
ENSMUSE00000144029 CDS CDS
ENSMUSE00000144035 CDS CDS + stop codon + UTR
ENSMUSE00000144028 NTF2 (6/149 aa) CDS
ENSMUSE00000144036 NTF2 (37/149 aa) CDS
ENSMUSE00000144044 NTF2 (21/149 aa) CDS
ENSMUSE00000144040 NTF2 (39/149 aa) CDS
ENSMUSE00000144042 NTF2 (15/149 aa) CDS
ENSMUSE00000144039 NTF2 (25/149 aa) CDS
ENSMUSE00000144034 NTF2 (11/149 aa) | TAP_C (19/51 aa) CDS
ENSMUSE00000144045 TAP_C (21/51 aa) CDS
ENSMUSE00000643342 TAP_C (12/51 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0685_6_D03 PG00214_z_3_G02 Nxf1tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_3_D09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_3_E10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_4_C07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_3_A03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_3_D01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_3_E06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_3_F10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_3_D07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_3_E02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 80353 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00214_z_3_G02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
80353 Knockout-First - Reporter Tagged Insertion PCS00214_A_C04