IKMC Project Report - EUCOMM (ID: 83025)
M6pr MGI:96904 ENSMUSG00000007458 OTTMUSG00000023879
Mice no data available
Mutagenesis Predictions
This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000007602 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MFPFSGCWRTELLLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKR*
|
||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000112610 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MFPFSGCWRTELLLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKR*
|
||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000123093 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0693_8_F11 | HTGR03008_Y_3_G03 | M6prtm1a(EUCOMM)Hmgu | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | HEPD0693_8_A09 | HTGR03008_Y_3_G03 | M6prtm1a(EUCOMM)Hmgu | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones Without Conditional Potential
Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0693_8_F12 | HTGR03008_Y_3_G03 | M6prtm1e(EUCOMM)Hmgu | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 42403 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR03008_Y_3_G03 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 42403 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR03008_Y_7_G03 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 42403 | Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) | HTGR03008_Z_3_G03 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 42403 | Knockout First, Reporter-tagged insertion with conditional potential | PCS03008_B_C01 |
| 42403 | Knockout First, Reporter-tagged insertion with conditional potential | PCS03008_A_C01 |