IKMC Project Report - EUCOMM (ID: 83025)

M6pr MGI:96904 ENSMUSG00000007458 OTTMUSG00000023879
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000007602 protein_coding No protein product (NMD) view

Predicted translation:

MFPFSGCWRTELLLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000692402 UTR UTR
ENSMUSE00000976347 (59/278 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000195464 (57/278 aa) CDS Deleted
ENSMUSE00000195462 (37/278 aa) CDS CDS + stop codon + UTR
ENSMUSE00000999471 (44/278 aa) CDS
ENSMUSE00001066652 (43/278 aa) CDS
ENSMUSE00000377172 (40/278 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112610 protein_coding No protein product (NMD) view

Predicted translation:

MFPFSGCWRTELLLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000692402 UTR UTR
ENSMUSE00000692401 UTR UTR
ENSMUSE00000976347 (59/278 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000195464 (57/278 aa) CDS Deleted
ENSMUSE00000195462 (37/278 aa) CDS CDS + stop codon + UTR
ENSMUSE00000999471 (44/278 aa) CDS
ENSMUSE00001066652 (43/278 aa) CDS
ENSMUSE00000377172 (40/278 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000123093 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0693_8_F11 HTGR03008_Y_3_G03 M6prtm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0693_8_A09 HTGR03008_Y_3_G03 M6prtm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0693_8_F12 HTGR03008_Y_3_G03 M6prtm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 42403 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03008_Y_3_G03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 42403 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03008_Y_7_G03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 42403 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR03008_Z_3_G03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
42403 Knockout First, Reporter-tagged insertion with conditional potential PCS03008_B_C01
42403 Knockout First, Reporter-tagged insertion with conditional potential PCS03008_A_C01