IKMC Project Report - EUCOMM (ID: 83340)

Fam216a MGI:1916198 ENSMUSG00000029463 OTTMUSG00000026647
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Microinjection in progress

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000031419 protein_coding No protein product (NMD) view

Predicted translation: 

MPSRWPGVAGPPALARTEGGEGSAGHSYPQNSKGTGEQHKADRIKEGHRVYAHIAKLQELWKTTQIQTIHIPKSMTDASF
LKVKNWVCI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000221639 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000221631 CDS CDS
ENSMUSE00000221626 CDS CDS
ENSMUSE00000221620 CDS Deleted
ENSMUSE00000189093 CDS Deleted
ENSMUSE00000189086 CDS CDS + stop codon + UTR
ENSMUSE00000338169 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0675_7_B06 HTGR03010_Z_4_D03 Fam216atm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_H07 HTGR03010_Z_4_D03 Fam216atm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_B05 HTGR03010_Z_4_D03 Fam216atm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_F06 HTGR03010_Z_4_D03 Fam216atm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_D08 HTGR03010_Z_4_D03 Fam216atm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0675_7_E05 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_G07 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_E07 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_A08 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_C08 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_A07 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_C05 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_F08 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_B08 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0675_7_H08 HTGR03010_Z_4_D03 Fam216atm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_D03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_C12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_D10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_C01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_A06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_D09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_C04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_H02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_B03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_F02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_C05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_A05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_C08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_B08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_B10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_A11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_E03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_H03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_G07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_A01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_C02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_A10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_C03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_H04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_A04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_B12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_G02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_A12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_G05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 45005 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR03010_Z_4_D02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
45005 Knockout-First - Reporter Tagged Insertion PCS03010_A_D04