IKMC Project Report - EUCOMM (ID: 84585)

Lrrc49 MGI:2442689 ENSMUSG00000047766 OTTMUSG00000023677
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000065603 protein_coding No protein product (NMD) view

Predicted translation:

MIPGKYRSVSGRAANNVNCGLHLVIQTSSLSDKNKVEFRLNRETPPFPGRLLQHDLERNYSSRQGDGRVISPSPRNKSSC
ISSTTNVTDLCGLDMRAATTSLSAFGDSSIQTPSKPRIRQGCHSAGPNVSGDHISLVSSSMPAFPILQRSSEEKTLYSDR
LTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNL
ENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQRLFLSFN
NITRKKKDAWHLLWPKKRRRRRGRVTSSPC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000734484 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001055381 CDS CDS
ENSMUSE00000992284 CDS CDS
ENSMUSE00000428176 CDS CDS
ENSMUSE00000964278 CDS CDS
ENSMUSE00001053570 CDS CDS
ENSMUSE00000464266 CDS CDS
ENSMUSE00001080681 Leu-rich_rpt (14/17 aa) CDS CDS
ENSMUSE00000966276 Leu-rich_rpt (3/17 aa) CDS CDS
ENSMUSE00000994535 CDS Deleted
ENSMUSE00000990563 CDS CDS + stop codon + UTR
ENSMUSE00001052418 CDS
ENSMUSE00001085096 CDS
ENSMUSE00001066131 CDS
ENSMUSE00001031232 CDS
ENSMUSE00000996703 CDS
ENSMUSE00000533288 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114034 protein_coding No protein product (NMD) view

Predicted translation:

MIPGKYRSVSGRAANNVNCGLHLVIQTSSLSDKNKVEFRLNRETPPFPGRLLQHDLERNYSSRQGDHISLVSSSMPAFPI
LQRSSEEKTLYSDRLTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRV
LLLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDV
DNLPCLQRLFLSFNNITRKKKDAWHLLWPKKRRRRRGRVTSSPC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000726259 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001055381 CDS CDS
ENSMUSE00000992284 CDS CDS
ENSMUSE00000964278 CDS CDS
ENSMUSE00001053570 CDS CDS
ENSMUSE00000464266 Leu-rich_rpt (10/17 aa) CDS CDS
ENSMUSE00001080681 Leu-rich_rpt (7/17 aa) | Leu-rich_rpt (14/17 aa) CDS CDS
ENSMUSE00000966276 Leu-rich_rpt (3/17 aa) CDS CDS
ENSMUSE00000994535 CDS Deleted
ENSMUSE00000990563 CDS CDS + stop codon + UTR
ENSMUSE00001052418 CDS
ENSMUSE00001085096 CDS
ENSMUSE00001066131 CDS
ENSMUSE00001031232 CDS
ENSMUSE00000996703 CDS
ENSMUSE00000533288 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000166168 protein_coding No protein product (NMD) view

Predicted translation:

MSGLQSLRYKVNCGLHLVIQTSSLSDKNKVEFRLNRETPPFPGRLLQHDLERNYSSRQGDGRVISPSPRNKSSCISSTTN
VTDLCGLDMRAATTSLSAFGDSSIQTPSKPRIRQGCHSAGPNVSGDHISLVSSSMPAFPILQRSSEEKTLYSDRLTLERQ
KLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNLENLKNL
DVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQRLFLSFNNITRKK
KDAWHLLWPKKRRRRRGRVTSSPC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000697828 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001055381 CDS CDS
ENSMUSE00000992284 CDS CDS
ENSMUSE00000428176 CDS CDS
ENSMUSE00000964278 CDS CDS
ENSMUSE00001053570 CDS CDS
ENSMUSE00000464266 CDS CDS
ENSMUSE00001080681 Leu-rich_rpt (14/17 aa) CDS CDS
ENSMUSE00000966276 Leu-rich_rpt (3/17 aa) CDS CDS
ENSMUSE00000994535 CDS Deleted
ENSMUSE00000990563 CDS CDS + stop codon + UTR
ENSMUSE00001052418 CDS
ENSMUSE00001085096 CDS
ENSMUSE00001066131 CDS
ENSMUSE00001031232 CDS
ENSMUSE00000996703 CDS
ENSMUSE00000697834 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114032 protein_coding No protein product (NMD) view

Predicted translation:

MSGLQSLRYKVNCGLHLVIQTSSLSDKNKVEFRLNRETPPFPGRLLQHDLERNYSSRQGDHISLVSSSMPAFPILQRSSE
EKTLYSDRLTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKN
RIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCL
QRLFLSFNNITRKKKDAWHLLWPKKRRRRRGRVTSSPC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000697828 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001055381 CDS CDS
ENSMUSE00000992284 CDS CDS
ENSMUSE00000964278 CDS CDS
ENSMUSE00001053570 CDS CDS
ENSMUSE00000464266 Leu-rich_rpt (10/17 aa) CDS CDS
ENSMUSE00001080681 Leu-rich_rpt (7/17 aa) | Leu-rich_rpt (14/17 aa) CDS CDS
ENSMUSE00000966276 Leu-rich_rpt (3/17 aa) CDS CDS
ENSMUSE00000994535 CDS Deleted
ENSMUSE00000990563 CDS CDS + stop codon + UTR
ENSMUSE00001052418 CDS
ENSMUSE00001085096 CDS
ENSMUSE00001066131 CDS
ENSMUSE00001031232 CDS
ENSMUSE00000996703 CDS
ENSMUSE00000697834 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000053171 protein_coding Residual C-terminal product view

Predicted translation:

MVTTVSFTFIEFDEIVQVLPKLKMKFPNSLHLKFRETNLVMLQQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRL
SHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRMISILGDARKKQFRYLLESKGKKPGIICEETSDSKRFLGE
NTNRATLNYTTREFYHEKLEEIKDKKKFCRLYVEDLVKEATAINMKNEALQKLWPQMFIELVRDAVIEIRSKDSYMKLCL
QQITDQK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000697824 UTR UTR
ENSMUSE00001073937 UTR + start codon + CDS Deleted
ENSMUSE00000990563 CDS
ENSMUSE00001052418 CDS
ENSMUSE00001085096 CDS UTR + start codon + CDS
ENSMUSE00001066131 CDS CDS
ENSMUSE00001031232 CDS CDS
ENSMUSE00000996703 CDS CDS
ENSMUSE00001037092 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00000378525 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000132366 protein_coding Target region does not overlap transcript
ENSMUST00000150060 nonsense_mediated_decay No protein product (NMD) view

Predicted translation:

MIPGKYRSVSGRAANNVNCGLHLVIQTSSLSDKNKVEFRLNRETPPFPGRLLQHDLERNYSSRQGDHISLVSSSMPAFPI
LQRSSEEKTLYSDRLTLERQKLTVCPIIDGEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRV
LLLGKNRIKKISNLENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDV
DNLPCLQRLFLSFNNITRKKKDAWHLLWPKKRRRRRGRVTSSPC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000838411 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001055381 CDS CDS
ENSMUSE00000992284 CDS CDS
ENSMUSE00000964278 CDS CDS
ENSMUSE00001053570 CDS CDS
ENSMUSE00000464266 Leu-rich_rpt (10/17 aa) CDS CDS
ENSMUSE00001080681 Leu-rich_rpt (7/17 aa) | Leu-rich_rpt (14/17 aa) CDS CDS
ENSMUSE00000966276 Leu-rich_rpt (3/17 aa) | Leu-rich_rpt (12/16 aa) CDS CDS
ENSMUSE00000994535 Leu-rich_rpt (5/16 aa) CDS Deleted
ENSMUSE00000972364 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001076332 UTR UTR
ENSMUSE00001056235 UTR UTR
ENSMUSE00001043891 UTR UTR
ENSMUSE00001093664 UTR UTR
ENSMUSE00001073900 UTR UTR
ENSMUSE00001034903 UTR UTR
ENSMUSE00000759705 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000128877 retained_intron No analysis available: incomplete transcript
ENSMUST00000136388 retained_intron Target region does not overlap transcript
ENSMUST00000150398 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0618_5_B11 PG00110_Z_2_B07 Lrrc49tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0618_5_B12 PG00110_Z_2_B07 Lrrc49tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0618_5_H10 PG00110_Z_2_B07 Lrrc49tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 102286 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00110_Z_2_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
102286 Knockout First, Reporter-tagged insertion with conditional potential PCS00110_A_B07