IKMC Project Report - EUCOMM (ID: 88929)

Jam2 MGI:1933820 ENSMUSG00000053062 OTTMUSG00000025168
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000114195 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MARSPQGLLMLLLLHYLIVALDYHKANGFSASKDHRQEVTVIEFQEAILACKTPKKTTSSRLEWKKVGQGVSLVYYQQAL
QAIQHDFQDGQWRVLLRSPELCRTPQVPWEANASRCSQHKRHHSNGCGGGLRDFCMWPWHMLCSEERLLFKRNFLPEGQS
CI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000698472 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000268247 Ig_V-set (11/85 aa) CDS CDS
ENSMUSE00000268240 Ig_V-set (37/85 aa) CDS CDS
ENSMUSE00000496500 Ig_V-set (39/85 aa) CDS Deleted
ENSMUSE00000993482 Ig_I-set (55/82 aa) | Ig_V-set (56/80 aa) | Immunoglobulin (50/68 aa) CDS Deleted
ENSMUSE00001037669 Ig_I-set (27/82 aa) | Ig_V-set (24/80 aa) | Immunoglobulin (18/68 aa) CDS CDS
ENSMUSE00000975280 CDS CDS
ENSMUSE00001077236 CDS CDS
ENSMUSE00001008897 CDS CDS + stop codon + UTR
ENSMUSE00000698468 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000098407 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MARSPQGLLMLLLLHYLIVALDYHKANGFSASKDHRQEVTVIEFQEAILACKTPKKTTSSRLEWKKVGQGVSLVYYQQAL
Q

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000698466 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000268247 Ig_V-set (11/85 aa) | Ig_I-set (9/82 aa) CDS CDS
ENSMUSE00000268240 Ig_V-set (37/85 aa) | Ig_I-set (37/82 aa) CDS CDS + stop codon + UTR
ENSMUSE00000634408 Ig_V-set (39/85 aa) | Ig_I-set (38/82 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000138054 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available