IKMC Project Report - EUCOMM (ID: 89156)

Abca1 MGI:99607 ENSMUSG00000015243 OTTMUSG00000007157
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Microinjection in progress

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000030010 protein_coding No protein product (NMD) view

Predicted translation: 

MACWPQLRLLLWKNLTFRRRQTATFRIKPCRLQEPSPGYRGLSVMPTTPASVIQLPARLPVLLETLTSPSCLACSQTLRG
FFCTAKEIPALRTCTRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000458891 UTR UTR
ENSMUSE00000366299 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000226982 CDS Deleted
ENSMUSE00000226974 CDS CDS
ENSMUSE00000409749 CDS CDS + stop codon + UTR
ENSMUSE00000226956 CDS
ENSMUSE00000178118 CDS
ENSMUSE00000226945 CDS
ENSMUSE00000385970 CDS
ENSMUSE00000226930 CDS
ENSMUSE00000226921 CDS
ENSMUSE00000226906 CDS
ENSMUSE00000178083 CDS
ENSMUSE00000178134 CDS
ENSMUSE00000339683 CDS
ENSMUSE00000337239 CDS
ENSMUSE00000386705 CDS
ENSMUSE00000178076 CDS
ENSMUSE00000352915 ABC_transporter-like (3/122 aa) CDS
ENSMUSE00000178129 ABC_transporter-like (45/122 aa) CDS
ENSMUSE00000178121 ABC_transporter-like (49/122 aa) CDS
ENSMUSE00000527248 ABC_transporter-like (28/122 aa) CDS
ENSMUSE00000178082 CDS
ENSMUSE00000178072 CDS
ENSMUSE00000398254 CDS
ENSMUSE00000178073 CDS
ENSMUSE00000178102 CDS
ENSMUSE00000407456 CDS
ENSMUSE00000178151 CDS
ENSMUSE00000178142 CDS
ENSMUSE00000378313 CDS
ENSMUSE00000413907 CDS
ENSMUSE00000178155 CDS
ENSMUSE00000412173 CDS
ENSMUSE00000226741 CDS
ENSMUSE00000370795 CDS
ENSMUSE00000527246 CDS
ENSMUSE00000226714 CDS
ENSMUSE00000226705 CDS
ENSMUSE00000226697 CDS
ENSMUSE00000178158 CDS
ENSMUSE00000178085 CDS
ENSMUSE00000178140 CDS
ENSMUSE00000178111 ABC_transporter-like (23/121 aa) CDS
ENSMUSE00001045186 ABC_transporter-like (48/121 aa) CDS
ENSMUSE00001063647 ABC_transporter-like (45/121 aa) CDS
ENSMUSE00001087064 ABC_transporter-like (6/121 aa) CDS
ENSMUSE00000996101 CDS
ENSMUSE00000380728 CDS
ENSMUSE00000374388 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000149127 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0720_5_E11 PG00225_Z_4_C06 Abca1tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0720_5_E09 PG00225_Z_4_C06 Abca1tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0720_5_A12 PG00225_Z_4_C06 Abca1tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0720_5_H09 PG00225_Z_4_C06 Abca1tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0720_5_A09 PG00225_Z_4_C06 Abca1tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0720_5_C12 PG00225_Z_4_C06 Abca1tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0720_5_B12 PG00225_Z_4_C06 Abca1tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0720_5_G11 PG00225_Z_4_C06 Abca1tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0720_5_H12 PG00225_Z_4_C06 Abca1tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 289129 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00225_Z_4_G04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 289129 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00225_Z_4_H04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 289129 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00225_Z_4_H05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 289129 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00225_Z_4_C06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 289129 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00225_Z_4_A12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 289129 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00225_Z_4_D01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 289129 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00225_Z_4_B05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 289129 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00225_Z_4_G07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 289129 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00225_Z_4_B12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
289129 Knockout-First - Reporter Tagged Insertion PCS00225_A_D06