IKMC Project Report - KOMP-CSD (ID: 89246)

E030002O03Rik MGI:2443346 ENSMUSG00000044265 OTTMUSG00000019016
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000051137 protein_coding No protein product (NMD) view

Predicted translation:

MQSDPALLASFLLLLPLVLPGQPQLVRNVLNSMDENGTFQCVVHLPNNSIFLQQLDQLQSTLQELISKYEQELSRVPVLM
EACRK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000820017 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000359594 CDS CDS
ENSMUSE00000413281 CDS Deleted
ENSMUSE00000372618 CDS Deleted
ENSMUSE00000394791 Olfac-like (46/254 aa) CDS CDS + stop codon + UTR
ENSMUSE00000353478 Olfac-like (209/254 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000154555 protein_coding No protein product (NMD) view

Predicted translation:

MQSDPALLASFLLLLPLVLPGQPQLVRNVLNSMDENGTFQCVVHLPNNSIFLQQLDQLQSTLQELISKYEQELSRVPVLM
EACRK*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000395919 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000359594 CDS CDS
ENSMUSE00000372618 CDS Deleted
ENSMUSE00000394791 Olfac-like (46/167 aa) CDS CDS + stop codon + UTR
ENSMUSE00000843401 Olfac-like (121/167 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available