IKMC Project Report - KOMP-CSD (ID: 89249)

Gm4847 MGI:3643320 ENSMUSG00000051081 OTTMUSG00000029828
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000046662 protein_coding No protein product (NMD) view

Predicted translation: 

MGVKRIAVIGAGVSGLGAIKCCLEEGLEPTCFEKKSDIGGLWKYEESASSKAAISTPGSTNTPTTLWGREWQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000687734 UTR UTR
ENSMUSE00000593334 Flavin_mOase-like (41/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (40/217 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001034251 Flavin_mOase-like (63/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (63/217 aa) CDS Deleted
ENSMUSE00001011157 Flavin_mOase-like (55/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (55/217 aa) CDS Deleted
ENSMUSE00001089176 Flavin_mOase-like (48/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (48/217 aa) CDS CDS + stop codon + UTR
ENSMUSE00001010266 Flavin_mOase-like (67/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (12/217 aa) CDS
ENSMUSE00001053461 Flavin_mOase-like (118/528 aa) CDS
ENSMUSE00000339570 Flavin_mOase-like (26/528 aa) CDS
ENSMUSE00000658721 Flavin_mOase-like (114/528 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0728_4_G03 HTGRS06017_A_A07 Gm4847tm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 50311 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGRS06017_A_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 50311 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06017_A_3_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 50311 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06017_A_4_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 50311 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06017_A_5_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 50311 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06017_A_6_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 50311 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06017_A_1_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 50311 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06017_A_2_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 50311 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06017_A_7_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 50311 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGR06017_A_8_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
50311 Knockout First, Reporter-tagged insertion with conditional potential PCS00072_A_H11
50311 Knockout First, Reporter-tagged insertion with conditional potential PCS06017_A_A07