IKMC Project Report - KOMP-CSD (ID: 89561)

Pdzk1ip1 MGI:1914432 ENSMUSG00000028716 OTTMUSG00000008589
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000106548 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MLAFSLLVLGLLAEVAPASCQQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000670425 UTR UTR
ENSMUSE00000670424 UTR + start codon + CDS
ENSMUSE00001052527 CDS Deleted
ENSMUSE00001046428 CDS Deleted
ENSMUSE00000265313 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000171877 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MGGGQFLFTSLPVLPPRPLSTSALPNPTSPLESDCSPADLIQTPQTSSSSRSQKHQQWTEVLQLPAAMLAFSLLVLGLLA
EVAPASCQQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000881158 UTR + start codon + CDS
ENSMUSE00001052527 CDS Deleted
ENSMUSE00001046428 CDS Deleted
ENSMUSE00000888555 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000030488 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MLAFSLLVLGLLAEVAPASCQQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000181644 UTR + start codon + CDS
ENSMUSE00001052527 CDS Deleted
ENSMUSE00001046428 CDS Deleted
ENSMUSE00000265313 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000177647 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MLAFSLLVLGLLAEVAPASCQQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000991759 UTR UTR
ENSMUSE00000998794 UTR + start codon + CDS
ENSMUSE00001052527 CDS Deleted
ENSMUSE00001046428 CDS Deleted
ENSMUSE00000888555 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000146578 processed_transcript No analysis available: incomplete transcript
ENSMUST00000139710 processed_transcript No analysis available: incomplete transcript
ENSMUST00000124491 processed_transcript No analysis available: incomplete transcript
ENSMUST00000149245 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0851_1_F10 PRPGS00230_A_G05 Pdzk1ip1tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) fail Vector Integrity fail
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00230_A_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00230_Z_4_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00230_Z_1_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00230_Z_2_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00230_Z_5_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00230_Z_5_H05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00230_Z_7_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00230_Z_6_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00230_Z_8_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 300869 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00230_Z_3_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
300869 Knockout-First - Reporter Tagged Insertion PCTS00230_A_G05