IKMC Project Report - KOMP-CSD (ID: 89572)

Wdr54 MGI:1922909 ENSMUSG00000030032 OTTMUSG00000026966
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000153148 protein_coding No protein product (NMD) view

Predicted translation: 

MFRRERSIPLRSSAAALSNNLSVLQLPARDLTHFGVVHGPSAQLLSAAPEGVPLAQRQLHVKEGAGVSPPLITQVHWCVL
PFRVLLVLTSHRGIQERVPVEYWSLISPLRVPTLYSARNWLGTRHQSQILPLSVPRGRMVLLTW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000331655 UTR UTR
ENSMUSE00001059271 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001069110 CDS CDS
ENSMUSE00001020171 CDS Deleted
ENSMUSE00001070420 CDS Deleted
ENSMUSE00001064374 CDS CDS
ENSMUSE00001001379 CDS CDS + stop codon + UTR
ENSMUSE00001034248 WD40_repeat (18/33 aa) CDS
ENSMUSE00000987813 WD40_repeat (15/33 aa) CDS
ENSMUSE00000752649 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000125894 protein_coding No analysis available: incomplete transcript
ENSMUST00000144723 retained_intron No analysis available: incomplete transcript
ENSMUST00000154625 retained_intron No analysis available: incomplete transcript
ENSMUST00000032108 processed_transcript No analysis available: incomplete transcript
ENSMUST00000146969 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_7_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_1_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_4_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_6_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00230_A_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_5_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_7_B07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_8_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_2_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_2_B07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 301272 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_3_A07 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
301272 Knockout First, Reporter-tagged insertion with conditional potential PCTS00230_A_A07