IKMC Project Report - KOMP-CSD (ID: 89574)

Efna3 MGI:106644 ENSMUSG00000028039 OTTMUSG00000028865
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000029673 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000673179 Ephrin (14/134 aa) UTR + start codon + CDS
ENSMUSE00001050847 Ephrin (98/134 aa) CDS Deleted
ENSMUSE00001029688 Ephrin (23/134 aa) CDS Deleted
ENSMUSE00000175395 Ephrin (2/134 aa) CDS Deleted
ENSMUSE00000673177 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000139439 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0848_3_A02 PRPGS00229_A_A08 Efna3tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0848_3_D01 PRPGS00229_A_A08 Efna3tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0848_3_A03 PRPGS00229_A_A08 Efna3tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 294289 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00229_Z_5_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 294289 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00229_Z_8_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 294289 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00229_Z_3_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 294289 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00229_A_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 294289 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00229_Z_1_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 294289 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00229_Z_6_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 294289 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00229_Z_7_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 294289 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00229_Z_4_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 294289 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00229_Z_2_A08 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
294289 Knockout First, Reporter-tagged insertion with conditional potential PCTS00229_A_A08