IKMC Project Report - KOMP-CSD (ID: 89710)

Trp73 MGI:1336991 ENSMUSG00000029026 OTTMUSG00000010497
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 6 are protein-coding. Following removal of the floxed region, 6 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000105644 protein_coding No protein product (NMD) view

Predicted translation: 

MSGSVGEMAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGMAQFNLLSSAMDQMGSRAAP
ASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTDSLPRLATSSV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000448869 UTR UTR
ENSMUSE00000996408 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000302144 CDS CDS
ENSMUSE00001077477 p53_DNA-bd (29/196 aa) CDS CDS
ENSMUSE00000895857 p53_DNA-bd (63/196 aa) CDS Deleted
ENSMUSE00000184681 p53_DNA-bd (39/196 aa) CDS CDS + stop codon + UTR
ENSMUSE00000523788 p53_DNA-bd (37/196 aa) CDS
ENSMUSE00000914698 p53_DNA-bd (30/196 aa) CDS
ENSMUSE00000184689 p53_tetrameristn (13/40 aa) CDS
ENSMUSE00000184688 p53_tetrameristn (27/40 aa) CDS
ENSMUSE00000184682 CDS
ENSMUSE00000985607 SAM_2 (9/64 aa) CDS
ENSMUSE00000964749 SAM_2 (32/64 aa) CDS
ENSMUSE00000826593 SAM_2 (24/64 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000133533 protein_coding No protein product (NMD) view

Predicted translation: 

MLYVGDPMRHLATAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEV
TFQQSSTAKSATWTDSLPRLATSSV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000771472 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001077477 p53_DNA-bd (29/196 aa) CDS CDS
ENSMUSE00000895857 p53_DNA-bd (63/196 aa) CDS Deleted
ENSMUSE00000184681 p53_DNA-bd (39/196 aa) CDS CDS + stop codon + UTR
ENSMUSE00000523788 p53_DNA-bd (37/196 aa) CDS
ENSMUSE00000914698 p53_DNA-bd (30/196 aa) CDS
ENSMUSE00000184689 p53_tetrameristn (13/40 aa) CDS
ENSMUSE00000184688 p53_tetrameristn (27/40 aa) CDS
ENSMUSE00000184682 CDS
ENSMUSE00000985607 SAM_2 (9/64 aa) CDS
ENSMUSE00000964749 SAM_2 (32/64 aa) CDS
ENSMUSE00000826593 SAM_2 (24/64 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000097762 protein_coding No protein product (NMD) view

Predicted translation: 

MLYVGDPMRHLATAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEV
TFQQSSTAKSATWTDSLPRLATSSV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000771472 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001077477 p53_DNA-bd (29/196 aa) CDS CDS
ENSMUSE00000895857 p53_DNA-bd (63/196 aa) CDS Deleted
ENSMUSE00000184681 p53_DNA-bd (39/196 aa) CDS CDS + stop codon + UTR
ENSMUSE00000523788 p53_DNA-bd (37/196 aa) CDS
ENSMUSE00000914698 p53_DNA-bd (30/196 aa) CDS
ENSMUSE00000184689 p53_tetrameristn (13/40 aa) CDS
ENSMUSE00000184688 p53_tetrameristn (27/40 aa) CDS
ENSMUSE00000964749 SAM_2 (30/54 aa) CDS
ENSMUSE00000944362 SAM_2 (24/54 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000105643 protein_coding No protein product (NMD) view

Predicted translation: 

MLYVGDPMRHLATAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEV
TFQQSSTAKSATWTDSLPRLATSSV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000928778 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001077477 p53_DNA-bd (29/196 aa) CDS CDS
ENSMUSE00000895857 p53_DNA-bd (63/196 aa) CDS Deleted
ENSMUSE00000184681 p53_DNA-bd (39/196 aa) CDS CDS + stop codon + UTR
ENSMUSE00000523788 p53_DNA-bd (37/196 aa) CDS
ENSMUSE00000914698 p53_DNA-bd (30/196 aa) CDS
ENSMUSE00000184689 p53_tetrameristn (13/40 aa) CDS
ENSMUSE00000184688 p53_tetrameristn (27/40 aa) CDS
ENSMUSE00000184682 CDS
ENSMUSE00000985607 CDS
ENSMUSE00001073353 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000155642 protein_coding No analysis available: incomplete transcript
ENSMUST00000139634 protein_coding No analysis available: incomplete transcript
ENSMUST00000097763 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MLYVGDPMRHLATAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEV
TFQQSSTAKSATWTDSLPRLATSSV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000928778 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001077477 p53_DNA-bd (29/196 aa) CDS CDS
ENSMUSE00000895857 p53_DNA-bd (63/196 aa) CDS Deleted
ENSMUSE00000184681 p53_DNA-bd (39/196 aa) CDS CDS + stop codon + UTR
ENSMUSE00000523788 p53_DNA-bd (37/196 aa) CDS
ENSMUSE00000914698 p53_DNA-bd (30/196 aa) CDS
ENSMUSE00000184689 p53_tetrameristn (13/40 aa) CDS
ENSMUSE00000184688 p53_tetrameristn (27/40 aa) CDS
ENSMUSE00001008135 CDS + stop codon + UTR
ENSMUSE00000980915 UTR UTR
ENSMUSE00001077848 UTR UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0851_4_E03 PRPGS00231_A_A06 Trp73tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.8 - 0.71 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0851_4_D04 PRPGS00231_A_A06 Trp73tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.8 - 0.71 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0851_4_G03 PRPGS00231_A_A06 Trp73tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype 0.2 - 0.11 Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 354449 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00231_Z_4_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 354449 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00231_Z_3_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 354449 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00231_Z_8_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 354449 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00231_Z_6_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 354449 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00231_A_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 354449 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00231_Z_5_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 354449 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00231_Z_7_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 354449 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00231_Z_2_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 354449 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00231_Z_1_A06 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
354449 Knockout First, Reporter-tagged insertion with conditional potential PCTS00231_A_A06