IKMC Project Report - KOMP-CSD (ID: 89735)

Npas1 MGI:109205 ENSMUSG00000001988
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000002053 protein_coding No protein product (NMD) view

Predicted translation: 

MATPYPRSGGRGEVKCGGGRGAGVPWDFLPGLMVKAPPGPCPRPPRPCGSGL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000705948 UTR UTR
ENSMUSE00000198009 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000198006 HLH_DNA-bd (45/45 aa) CDS Deleted
ENSMUSE00000240265 PAS_fold (3/58 aa) CDS CDS + stop codon + UTR
ENSMUSE00000240256 PAS_fold (30/58 aa) CDS
ENSMUSE00000240249 PAS_fold (25/58 aa) CDS
ENSMUSE00000198005 CDS
ENSMUSE00000198001 PAS_fold_3 (5/73 aa) CDS
ENSMUSE00000198010 PAS_fold_3 (37/73 aa) CDS
ENSMUSE00000198004 PAS_fold_3 (33/73 aa) CDS
ENSMUSE00000198007 CDS
ENSMUSE00000388232 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0851_3_G03 PRPGS00230_A_E02 Npas1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0851_3_H04 PRPGS00230_A_E02 Npas1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR fail 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0851_3_E02 PRPGS00230_A_E02 Npas1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0851_3_D02 PRPGS00230_A_E02 Npas1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0851_3_C03 PRPGS00230_A_E02 Npas1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0851_3_A02 PRPGS00230_A_E02 Npas1tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_6_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_4_H01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_8_A03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_7_F02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_5_D02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_2_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_6_A03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_1_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_2_H01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_3_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_4_F02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_1_H01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_7_H01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_4_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_7_A03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_3_D02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_2_A03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_5_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_8_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00230_Z_8_H01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298139 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00230_A_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
298139 Knockout First, Reporter-tagged insertion with conditional potential PCTS00230_A_E02