IKMC Project Report - (ID: 89815)

non-BioMart die(): Cannot write to '/nfs/team87/services/biomart/ikmc-mart/production/server/releases/20110531105342/logs/log4perl_log': at /software/team87/brave_new_world/lib/perl5/Log/Log4perl/Appender/File.pm line 245.
Pre-pipeline Designs Vectors ES Cells Mice

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000063761 protein_coding No protein product (NMD) view

Predicted translation:

MAEAHQASSLLSSLSSDGAEVELSSPVWQEIYLCALRSWKRHLWRVWNDFLAGVVPATPLSWLFLFSTIQLACLLQLDPS
LGLMEKIKELLPDWSATGGKSLCTCALEAH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000595196 UTR UTR
ENSMUSE00000909634 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000595194 CDS CDS
ENSMUSE00000595193 CDS Deleted
ENSMUSE00000595192 Carn_acyl_trans (15/588 aa) CDS Deleted
ENSMUSE00000595191 Carn_acyl_trans (46/588 aa) CDS Deleted
ENSMUSE00000595190 Carn_acyl_trans (25/588 aa) CDS CDS + stop codon + UTR
ENSMUSE00000595189 Carn_acyl_trans (36/588 aa) CDS
ENSMUSE00000595188 Carn_acyl_trans (29/588 aa) CDS
ENSMUSE00000595187 Carn_acyl_trans (66/588 aa) CDS
ENSMUSE00000532190 Carn_acyl_trans (62/588 aa) CDS
ENSMUSE00000595186 Carn_acyl_trans (36/588 aa) CDS
ENSMUSE00000595185 Carn_acyl_trans (39/588 aa) CDS
ENSMUSE00000595184 Carn_acyl_trans (55/588 aa) CDS
ENSMUSE00000516454 Carn_acyl_trans (44/588 aa) CDS
ENSMUSE00000465964 Carn_acyl_trans (51/588 aa) CDS
ENSMUSE00000595183 Carn_acyl_trans (38/588 aa) CDS
ENSMUSE00000595182 Carn_acyl_trans (31/588 aa) CDS
ENSMUSE00000595181 Carn_acyl_trans (18/588 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available