IKMC Project Report - EUCOMM (ID: 89924)

Sncaip MGI:1915097 ENSMUSG00000024534 OTTMUSG00000042341
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 11 wild type transcripts, of which 8 are protein-coding. Following removal of the floxed region, 8 transcripts are predicted to produce a truncated protein product of which 5 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000178011 protein_coding No protein product (NMD) view

Predicted translation: 

MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRSATPSCRQSGQNSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000905158 UTR UTR
ENSMUSE00000625404 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000572515 CDS CDS
ENSMUSE00000238192 CDS Deleted
ENSMUSE00000572514 CDS CDS + stop codon + UTR
ENSMUSE00001051210 CDS
ENSMUSE00000984926 Ankyrin_rpt (17/31 aa) CDS
ENSMUSE00000994641 Ankyrin_rpt (14/31 aa) CDS
ENSMUSE00001000393 CDS
ENSMUSE00001047090 CDS
ENSMUSE00001042443 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000115410 protein_coding No protein product (NMD) view

Predicted translation: 

MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRSATPSCRQSGQNSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000702770 UTR UTR
ENSMUSE00000625404 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000572515 CDS CDS
ENSMUSE00000238192 CDS Deleted
ENSMUSE00000572514 CDS CDS + stop codon + UTR
ENSMUSE00001051210 CDS
ENSMUSE00000984926 Ankyrin_rpt (17/31 aa) CDS
ENSMUSE00000994641 Ankyrin_rpt (14/31 aa) CDS
ENSMUSE00001000393 CDS
ENSMUSE00000702769 CDS
ENSMUSE00000971518 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000178678 protein_coding No protein product (NMD) view

Predicted translation: 

MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRSATPSCRQSGQNSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001044470 UTR UTR
ENSMUSE00000625404 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000572515 CDS CDS
ENSMUSE00000238192 CDS Deleted
ENSMUSE00000572514 CDS CDS + stop codon + UTR
ENSMUSE00001051210 CDS
ENSMUSE00000984926 Ankyrin_rpt (17/31 aa) CDS
ENSMUSE00000994641 Ankyrin_rpt (14/31 aa) CDS
ENSMUSE00001000393 CDS
ENSMUSE00001047090 CDS
ENSMUSE00001000397 CDS
ENSMUSE00000702768 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000025413 protein_coding No protein product (NMD) view

Predicted translation: 

MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRSATPSCRQSGQNSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000659362 UTR UTR
ENSMUSE00000625404 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000572515 CDS CDS
ENSMUSE00000238192 CDS Deleted
ENSMUSE00000572514 CDS CDS + stop codon + UTR
ENSMUSE00001051210 CDS
ENSMUSE00000984926 Ankyrin_rpt (17/31 aa) CDS
ENSMUSE00000994641 Ankyrin_rpt (14/31 aa) CDS
ENSMUSE00001000393 CDS
ENSMUSE00001047090 CDS
ENSMUSE00001000397 CDS
ENSMUSE00000238138 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000163742 protein_coding No protein product (NMD) view

Predicted translation: 

MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRSATPSCRQSGQNSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001063588 UTR UTR
ENSMUSE00000625404 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000572515 CDS CDS
ENSMUSE00000238192 CDS Deleted
ENSMUSE00000572514 CDS CDS + stop codon + UTR
ENSMUSE00001051210 CDS
ENSMUSE00000984926 Ankyrin_rpt (17/31 aa) CDS
ENSMUSE00000994641 Ankyrin_rpt (14/31 aa) CDS
ENSMUSE00001000393 CDS
ENSMUSE00001047090 CDS
ENSMUSE00000995028 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000179625 protein_coding No analysis available: incomplete transcript
ENSMUST00000179689 protein_coding No analysis available: incomplete transcript
ENSMUST00000179038 protein_coding Target region does not overlap transcript
ENSMUST00000177861 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000178883 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000180259 nonsense_mediated_decay No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0724_4_D01 HTGRS6004_A_F01 Sncaiptm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_C03 HTGRS6004_A_F01 Sncaiptm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_G03 HTGRS6004_A_F01 Sncaiptm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_B02 HTGRS6004_A_F01 Sncaiptm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0724_4_G01 HTGRS6004_A_F01 Sncaiptm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_C04 HTGRS6004_A_F01 Sncaiptm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_E02 HTGRS6004_A_F01 Sncaiptm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_F01 HTGRS6004_A_F01 Sncaiptm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_B01 HTGRS6004_A_F01 Sncaiptm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_E01 HTGRS6004_A_F01 Sncaiptm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_F03 HTGRS6004_A_F01 Sncaiptm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_A04 HTGRS6004_A_F01 Sncaiptm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0724_4_A01 HTGRS6004_A_F01 Sncaiptm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 94419 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) HTGRS6004_A_F01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
94419 Knockout First, Reporter-tagged insertion with conditional potential PCS6004_A_F01