IKMC Project Report - KOMP-CSD (ID: 89955)

B230118H07Rik MGI:1915420 ENSMUSG00000027165 OTTMUSG00000014583
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 12 wild type transcripts, of which 8 are protein-coding. Following removal of the floxed region, 8 transcripts are predicted to produce a truncated protein product of which 5 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000111231 protein_coding No protein product (NMD) view

Predicted translation: 

MLAQIPRPEIMDEDQLMKEVLDKFVNCHEQTYEEFLSTFTHLSKDCD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000687145 UTR UTR
ENSMUSE00000166473 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000166472 CDS Deleted
ENSMUSE00000166467 CDS CDS + stop codon + UTR
ENSMUSE00000166470 CDS
ENSMUSE00000968877 CDS
ENSMUSE00000788440 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000090513 protein_coding No protein product (NMD) view

Predicted translation: 

MLAQIPRPEIMDEDQLMKEVLDKFVNCHEQTYEEFLSTFTHLSKDCD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000687139 UTR UTR
ENSMUSE00000166473 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000166472 CDS Deleted
ENSMUSE00000166467 CDS CDS + stop codon + UTR
ENSMUSE00000166470 CDS
ENSMUSE00000968877 CDS
ENSMUSE00000564549 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000160037 protein_coding No protein product (NMD) view

Predicted translation: 

MLAQIPRPEIMDEDQLMKEVLDKFVNCHEQTYEEFLSTFTHLSKDCD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000851020 UTR UTR
ENSMUSE00000867901 UTR UTR
ENSMUSE00000166473 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000166472 CDS Deleted
ENSMUSE00000166467 CDS CDS + stop codon + UTR
ENSMUSE00000166470 CDS
ENSMUSE00000968877 CDS
ENSMUSE00000564549 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000160722 protein_coding No protein product (NMD) view

Predicted translation: 

MLAQIPRPEIMDEDQLMKEVLDKFVNCHEQTYEEFLSTFTHLSKDCD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000851020 UTR UTR
ENSMUSE00000166473 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000166472 CDS Deleted
ENSMUSE00000166467 CDS CDS + stop codon + UTR
ENSMUSE00000166470 CDS
ENSMUSE00000968877 CDS
ENSMUSE00000564549 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000099682 protein_coding No protein product (NMD) view

Predicted translation: 

MLAQIPRPEIMDEDQLMKEVLDKFVNCHEQTYEEFLSTFTHLSKDCD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000687137 UTR UTR
ENSMUSE00000166473 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000166472 CDS Deleted
ENSMUSE00000166467 CDS CDS + stop codon + UTR
ENSMUSE00000166470 CDS
ENSMUSE00000968877 CDS
ENSMUSE00000687136 CDS + stop codon + UTR
ENSMUSE00000687135 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000128898 protein_coding No analysis available: incomplete transcript
ENSMUST00000136601 protein_coding No analysis available: incomplete transcript
ENSMUST00000177152 protein_coding Target region does not overlap transcript
ENSMUST00000177007 retained_intron Target region does not overlap transcript
ENSMUST00000132640 retained_intron Target region does not overlap transcript
ENSMUST00000138903 processed_transcript Target region does not overlap transcript
ENSMUST00000177171 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_1_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_2_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_7_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_1_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_5_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_8_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00233_A_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_8_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_3_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_5_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_6_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_4_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_2_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_6_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_7_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_3_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 296660 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00233_Z_4_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
296660 Knockout First, Reporter-tagged insertion with conditional potential PCS00233_A_E01