IKMC Project Report - KOMP-CSD (ID: 90065)

H13 MGI:95886 ENSMUSG00000019188 OTTMUSG00000015824
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Microinjection in progress

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000089059 protein_coding No protein product (NMD) view

Predicted translation: 

MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKSSSDMPETITSRDAARFPI
IASCTLLGLYLFFKPLHE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000331982 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001029677 Peptidase_A22B_SPP (30/284 aa) CDS CDS
ENSMUSE00000279674 Peptidase_A22B_SPP (28/284 aa) CDS Deleted
ENSMUSE00000169802 Peptidase_A22B_SPP (31/284 aa) CDS CDS + stop codon + UTR
ENSMUSE00000485744 Peptidase_A22B_SPP (29/284 aa) CDS
ENSMUSE00000481144 Peptidase_A22B_SPP (42/284 aa) CDS
ENSMUSE00000169792 Peptidase_A22B_SPP (20/284 aa) CDS
ENSMUSE00000169796 Peptidase_A22B_SPP (29/284 aa) CDS
ENSMUSE00000169800 Peptidase_A22B_SPP (13/284 aa) CDS
ENSMUSE00000169798 Peptidase_A22B_SPP (35/284 aa) CDS
ENSMUSE00000169795 Peptidase_A22B_SPP (29/284 aa) CDS
ENSMUSE00000442550 Peptidase_A22B_SPP (4/284 aa) CDS + stop codon + UTR
ENSMUSE00000509377 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000125366 protein_coding No protein product (NMD) view

Predicted translation: 

MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKSSSDMPETITSRDAARFPI
IASCTLLGLYLFFKPLHE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000796695 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001029677 Peptidase_A22B_SPP (30/285 aa) CDS CDS
ENSMUSE00000279674 Peptidase_A22B_SPP (28/285 aa) CDS Deleted
ENSMUSE00000169802 Peptidase_A22B_SPP (31/285 aa) CDS CDS + stop codon + UTR
ENSMUSE00000485744 Peptidase_A22B_SPP (29/285 aa) CDS
ENSMUSE00000481144 Peptidase_A22B_SPP (42/285 aa) CDS
ENSMUSE00000169792 Peptidase_A22B_SPP (20/285 aa) CDS
ENSMUSE00000169796 Peptidase_A22B_SPP (29/285 aa) CDS
ENSMUSE00000169800 Peptidase_A22B_SPP (13/285 aa) CDS
ENSMUSE00000169798 Peptidase_A22B_SPP (35/285 aa) CDS
ENSMUSE00000169795 Peptidase_A22B_SPP (29/285 aa) CDS
ENSMUSE00000836419 Peptidase_A22B_SPP (5/285 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000109825 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKSSSDMPETITSRDAARFPI
IASCTLLGLYLFFKPLHE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000331982 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001029677 Peptidase_A22B_SPP (30/87 aa) CDS CDS
ENSMUSE00000279674 Peptidase_A22B_SPP (28/87 aa) CDS Deleted
ENSMUSE00000681724 Peptidase_A22B_SPP (30/87 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000079247 protein_coding No analysis available: incomplete transcript
ENSMUST00000148156 retained_intron No analysis available: incomplete transcript
ENSMUST00000129439 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0867_5_C04 PRPGS00235_A_E02 H13tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0867_5_E04 PRPGS00235_A_E02 H13tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0867_5_F02 PRPGS00235_A_E02 H13tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0867_5_B04 PRPGS00235_A_E02 H13tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0867_5_D04 PRPGS00235_A_E02 H13tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0867_5_G03 PRPGS00235_A_E02 H13tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_1_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_3_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_4_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00235_A_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_6_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_5_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_1_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_7_E01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_6_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_2_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_8_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 298693 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00235_Z_7_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
298693 Knockout First, Reporter-tagged insertion with conditional potential PCS00235_A_E02