IKMC Project Report - EUCOMM (ID: 92080)
1110008F13Rik MGI:1914638 ENSMUSG00000027637 OTTMUSG00000016066
Mice no data available
Mutagenesis Predictions
This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000029165 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||
|
Predicted translation: MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWDDKILPDQCRSSVSLLQ*
|
||||||||||||||||||||||||||||||
| ENSMUST00000152942 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||
| ENSMUST00000152551 | processed_transcript | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||
| ENSMUST00000126767 | processed_transcript | Target region does not overlap transcript | ||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0767_3_C12 | PG00248_Z_4_B02 | 1110008F13Riktm1a(EUCOMM)Hmgu | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | HEPD0767_3_G10 | PG00248_Z_4_B02 | 1110008F13Riktm1a(EUCOMM)Hmgu | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones Without Conditional Potential
Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0767_3_H12 | PG00248_Z_4_B02 | 1110008F13Riktm1e(EUCOMM)Hmgu | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | HEPD0767_3_H09 | PG00248_Z_4_B02 | 1110008F13Riktm1e(EUCOMM)Hmgu | Targeted Non-Conditional (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 375100 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00248_Z_4_B02 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 375100 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00248_Z_4_C12 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 375100 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00248_Z_4_F11 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 375100 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00248_Z_4_D04 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 375100 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00248_Z_4_H06 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 375100 | Knockout-First - Reporter Tagged Insertion | PCS00248_A_D01 |