IKMC Project Report - EUCOMM (ID: 92253)

F11 MGI:99481 ENSMUSG00000031645
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000034064 protein_coding No protein product (NMD) view

Predicted translation: 

MTSLHQVLYFIFFASVSSECVTKVFKDISFQGGDLSTVFTPSATYCRLVCTHHPRCLLFTFMAESSSDDPTKWFACILKD
SVTEILPMVNMTGAISGYSFKQCPQQLSIKCVF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000281998 UTR UTR
ENSMUSE00000281991 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000281983 PAN-1_domain (51/78 aa) CDS CDS
ENSMUSE00000281973 PAN-1_domain (28/78 aa) CDS CDS
ENSMUSE00000281968 PAN-1_domain (47/79 aa) CDS Deleted
ENSMUSE00000281959 PAN-1_domain (33/79 aa) CDS CDS + stop codon + UTR
ENSMUSE00000211436 PAN-1_domain (49/81 aa) CDS
ENSMUSE00000211445 PAN-1_domain (33/81 aa) CDS
ENSMUSE00000211442 PAN-1_domain (47/80 aa) CDS
ENSMUSE00000211432 PAN-1_domain (34/80 aa) CDS
ENSMUSE00000211443 Peptidase_S1_S6 (44/228 aa) | Peptidase_S1A_nudel (34/118 aa) CDS
ENSMUSE00000211440 Peptidase_S1_S6 (60/228 aa) | Peptidase_S1A_nudel (60/118 aa) CDS
ENSMUSE00000211438 Peptidase_S1_S6 (33/228 aa) | Peptidase_S1A_nudel (26/118 aa) CDS
ENSMUSE00001048232 Peptidase_S1_S6 (47/228 aa) CDS
ENSMUSE00000281904 Peptidase_S1_S6 (47/228 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 367380 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04020_Z_4_F01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 367380 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04020_Z_4_G11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
367380 Knockout-First - Reporter Tagged Insertion PCS04020_A_D09