IKMC Project Report - EUCOMM (ID: 92490)

Rab40b MGI:2183451 ENSMUSG00000025170 OTTMUSG00000004681
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000106107 protein_coding No protein product (NMD) view

Predicted translation: 

MMSSLGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGTPRGRGDFVPYSAHTPEVHRVWSWSMTLPTD
GPLMALIDGLRRLMSMPLGFLKSWWEIGCTWHSSDRCPLNRPRPTPSAWV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000749912 Small_GTPase (32/159 aa) | MIRO-like (32/113 aa) | Small_GTPase_ARF/SAR (33/113 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000976381 Small_GTPase (21/159 aa) | MIRO-like (21/113 aa) | Small_GTPase_ARF/SAR (21/113 aa) CDS Deleted
ENSMUSE00001065078 Small_GTPase (21/159 aa) | MIRO-like (21/113 aa) | Small_GTPase_ARF/SAR (21/113 aa) CDS CDS
ENSMUSE00001054496 Small_GTPase (26/159 aa) | MIRO-like (26/113 aa) | Small_GTPase_ARF/SAR (26/113 aa) CDS CDS
ENSMUSE00000148507 Small_GTPase (61/159 aa) | MIRO-like (15/113 aa) | Small_GTPase_ARF/SAR (14/113 aa) CDS CDS + stop codon + UTR
ENSMUSE00000725271 SOCS_C (35/35 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000149948 processed_transcript No analysis available: incomplete transcript
ENSMUST00000124639 processed_transcript No analysis available: incomplete transcript
ENSMUST00000135290 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0760_4_B11 PG00245_Z_6_A06 Rab40btm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0760_4_C11 PG00245_Z_6_A06 Rab40btm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0760_4_B12 PG00245_Z_6_A06 Rab40btm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0760_4_B10 PG00245_Z_6_A06 Rab40btm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0760_4_D12 PG00245_Z_6_A06 Rab40btm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0760_4_H12 PG00245_Z_6_A06 Rab40btm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0760_4_C10 PG00245_Z_6_A06 Rab40btm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0760_4_D11 PG00245_Z_6_A06 Rab40btm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_A06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_H03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_E06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_G01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_A01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_C08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_C10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_H11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_F06 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_B09 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_D03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_C03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_A05 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_B07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_B03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_H07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_G03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_G08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_D10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_E02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_H12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372859 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00245_Z_6_A10 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
372859 Knockout-First - Reporter Tagged Insertion PCS00245_A_F04