IKMC Project Report - EUCOMM (ID: 92688)

Eci2 MGI:1346064 ENSMUSG00000021417 OTTMUSG00000035939
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 13 wild type transcripts, of which 10 are protein-coding. Following removal of the floxed region, 10 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000171229 protein_coding No protein product (NMD) view

Predicted translation: 

MAAVTWSRARCWCPSVLQVFRLQVAKLHLGRPTMRASQQDFENALNQVKLLKKDPGNEVKLRLYALYKQATEGPCNMPKP
GMLDFVNKAKWDAWNALGSLPKETARQNYVDLVSSLSSSSEAPSQGKRGADEKARESKDILVTSEDGITKITFNRPTKKN
AISFQELVTTTAVGMT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001016389 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001018678 Acyl-CoA-binding_protein (31/82 aa) CDS CDS
ENSMUSE00000984631 Acyl-CoA-binding_protein (33/82 aa) CDS CDS
ENSMUSE00001009777 Crotonase_core (15/170 aa) | Acyl-CoA-binding_protein (18/82 aa) CDS CDS
ENSMUSE00001094711 Crotonase_core (24/170 aa) CDS Deleted
ENSMUSE00001054742 Crotonase_core (34/170 aa) CDS CDS + stop codon + UTR
ENSMUSE00000973127 Crotonase_core (41/170 aa) CDS
ENSMUSE00000965648 Crotonase_core (30/170 aa) CDS
ENSMUSE00001013173 Crotonase_core (28/170 aa) CDS
ENSMUSE00000915416 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000021854 protein_coding No protein product (NMD) view

Predicted translation: 

MRASQQDFENALNQVKLLKKDPGNEVKLRLYALYKQATEGPCNMPKPGMLDFVNKAKWDAWNALGSLPKETARQNYVDLV
SSLSSSSEAPSQGKRGADEKARESKDILVTSEDGITKITFNRPTKKNAISFQELVTTTAVGMT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000888177 UTR UTR
ENSMUSE00000985948 Acyl-CoA-binding_protein (31/82 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000984631 Acyl-CoA-binding_protein (33/82 aa) CDS CDS
ENSMUSE00001009777 Crotonase_core (15/170 aa) | Acyl-CoA-binding_protein (18/82 aa) CDS CDS
ENSMUSE00001094711 Crotonase_core (24/170 aa) CDS Deleted
ENSMUSE00001054742 Crotonase_core (34/170 aa) CDS CDS + stop codon + UTR
ENSMUSE00000973127 Crotonase_core (41/170 aa) CDS
ENSMUSE00000965648 Crotonase_core (30/170 aa) CDS
ENSMUSE00001013173 Crotonase_core (28/170 aa) CDS
ENSMUSE00000117705 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000110251 protein_coding No protein product (NMD) view

Predicted translation: 

MLVSEVFRLQVAKLHLGRPTMRASQQDFENALNQVKLLKKDPGNEVKLRLYALYKQATEGPCNMPKPGMLDFVNKAKWDA
WNALGSLPKETARQNYVDLVSSLSSSSEAPSQGKRGADEKARESKDILVTSEDGITKITFNRPTKKNAISFQELVTTTAV
GMT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001020405 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001022359 Acyl-CoA-binding_protein (31/82 aa) CDS CDS
ENSMUSE00000984631 Acyl-CoA-binding_protein (33/82 aa) CDS CDS
ENSMUSE00001009777 Crotonase_core (15/170 aa) | Acyl-CoA-binding_protein (18/82 aa) CDS CDS
ENSMUSE00001094711 Crotonase_core (24/170 aa) CDS Deleted
ENSMUSE00001054742 Crotonase_core (34/170 aa) CDS CDS + stop codon + UTR
ENSMUSE00000973127 Crotonase_core (41/170 aa) CDS
ENSMUSE00000965648 Crotonase_core (30/170 aa) CDS
ENSMUSE00001013173 Crotonase_core (28/170 aa) CDS
ENSMUSE00000875475 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000178421 protein_coding No protein product (NMD) view

Predicted translation: 

MRASQQDFENALNQVKLLKKDPGNEVKLRLYALYKQATEGPCNMPKPGMLDFVNKAKWDAWNALGSLPKETARQNYVDLV
SSLSSSSEAPSQGKRGADEKARESKDILVTSEDGITKITFNRPTKKNAISFQELVTTTAVGMT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001040541 UTR UTR
ENSMUSE00001032297 Acyl-CoA-binding_protein (31/82 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000984631 Acyl-CoA-binding_protein (33/82 aa) CDS CDS
ENSMUSE00001009777 Crotonase_core (15/170 aa) | Acyl-CoA-binding_protein (18/82 aa) CDS CDS
ENSMUSE00001094711 Crotonase_core (24/170 aa) CDS Deleted
ENSMUSE00001054742 Crotonase_core (34/170 aa) CDS CDS + stop codon + UTR
ENSMUSE00000973127 Crotonase_core (41/170 aa) CDS
ENSMUSE00000965648 Crotonase_core (30/170 aa) CDS
ENSMUSE00001013173 Crotonase_core (28/170 aa) CDS
ENSMUSE00001025056 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000170538 protein_coding No analysis available: incomplete transcript
ENSMUST00000163280 protein_coding No analysis available: incomplete transcript
ENSMUST00000170989 protein_coding No analysis available: incomplete transcript
ENSMUST00000167036 protein_coding No analysis available: incomplete transcript
ENSMUST00000171258 protein_coding No analysis available: incomplete transcript
ENSMUST00000169759 protein_coding Target region does not overlap transcript
ENSMUST00000166109 processed_transcript No analysis available: incomplete transcript
ENSMUST00000084345 retained_intron No analysis available: incomplete transcript
ENSMUST00000164421 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0716_1_A10 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_A09 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_D12 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_E12 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_D10 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_H12 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_E11 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_F09 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_H09 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_A11 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_B10 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_A12 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_D09 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_B09 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_D11 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_F12 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_C11 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_G12 PG00222_Z_3_E04 Eci2tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0716_1_G09 PG00222_Z_3_E04 Eci2tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_G10 PG00222_Z_3_E04 Eci2tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_F11 PG00222_Z_3_E04 Eci2tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0716_1_E09 PG00222_Z_3_E04 Eci2tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_C03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_A11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_C09 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_C05 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_B04 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_D07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_E04 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_C11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_A07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Z_3_H08 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_H08 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_B11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_C07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Z_3_C07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_B08 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_A06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_D02 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Y_3_A04 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278131 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00222_Z_3_E04 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
278131 Knockout First, Reporter-tagged insertion with conditional potential PCS00222_A_C03