IKMC Project Report - EUCOMM (ID: 92954)

0610012H03Rik MGI:1921338 ENSMUSG00000055312 OTTMUSG00000014989
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000068813 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAMRRLLRNICLPWNHRNSDAAITMIPWAWRLLPRNAARSVSTSSANQRAEDPHRQLEAYGYFLPIQTRWQDNDQNSHVN
NAVYYSYFDTVISHYLI

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000789397 UTR UTR
ENSMUSE00000441679 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001082050 Thioestr_supf (21/80 aa) CDS CDS + stop codon + UTR
ENSMUSE00000441675 Thioestr_supf (60/80 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000131060 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 376763 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00248_Z_8_G03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
376763 Knockout First, Reporter-tagged insertion with conditional potential PCS00248_A_H01