IKMC Project Report - EUCOMM (ID: 93147)

Vamp4 MGI:1858730 ENSMUSG00000026696 OTTMUSG00000033107
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 5 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000050010 protein_coding No protein product (NMD) view

Predicted translation:

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKQKLIG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000457856 UTR UTR
ENSMUSE00001001872 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001050054 CDS CDS
ENSMUSE00001002100 Synaptobrevin (5/86 aa) CDS CDS
ENSMUSE00001023316 Synaptobrevin (35/86 aa) CDS Deleted
ENSMUSE00001093029 Synaptobrevin (27/86 aa) CDS CDS + stop codon + UTR
ENSMUSE00001006622 Synaptobrevin (18/86 aa) CDS
ENSMUSE00000457838 Synaptobrevin (4/86 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000132158 protein_coding No protein product (NMD) view

Predicted translation:

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKQKLIG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000769054 UTR UTR
ENSMUSE00001001872 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001050054 CDS CDS
ENSMUSE00001002100 Synaptobrevin (5/86 aa) CDS CDS
ENSMUSE00001023316 Synaptobrevin (35/86 aa) CDS Deleted
ENSMUSE00001093029 Synaptobrevin (27/86 aa) CDS CDS + stop codon + UTR
ENSMUSE00001006622 Synaptobrevin (18/86 aa) CDS
ENSMUSE00000811881 Synaptobrevin (4/86 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000135241 protein_coding No protein product (NMD) view

Predicted translation:

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKQKLIG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000756917 UTR UTR
ENSMUSE00001001872 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001050054 CDS CDS
ENSMUSE00001002100 Synaptobrevin (5/87 aa) CDS CDS
ENSMUSE00001023316 Synaptobrevin (35/87 aa) CDS Deleted
ENSMUSE00001093029 Synaptobrevin (27/87 aa) CDS CDS + stop codon + UTR
ENSMUSE00001006622 Synaptobrevin (18/87 aa) CDS
ENSMUSE00000791309 Synaptobrevin (5/87 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000155003 protein_coding No protein product (NMD) view

Predicted translation:

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKQKLIG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000748313 UTR UTR
ENSMUSE00001001872 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001050054 CDS CDS
ENSMUSE00001002100 Synaptobrevin (5/87 aa) CDS CDS
ENSMUSE00001023316 Synaptobrevin (35/87 aa) CDS Deleted
ENSMUSE00001093029 Synaptobrevin (27/87 aa) CDS CDS + stop codon + UTR
ENSMUSE00001006622 Synaptobrevin (18/87 aa) CDS
ENSMUSE00000791309 Synaptobrevin (5/87 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000150040 protein_coding No protein product (NMD) view

Predicted translation:

MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKQKLIG*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000845736 UTR UTR
ENSMUSE00001001872 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001050054 CDS CDS
ENSMUSE00001002100 Synaptobrevin (5/87 aa) CDS CDS
ENSMUSE00001023316 Synaptobrevin (35/87 aa) CDS Deleted
ENSMUSE00001093029 Synaptobrevin (27/87 aa) CDS CDS + stop codon + UTR
ENSMUSE00001006622 Synaptobrevin (18/87 aa) CDS
ENSMUSE00000785180 Synaptobrevin (5/87 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000138499 processed_transcript No analysis available: incomplete transcript
ENSMUST00000128704 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available