IKMC Project Report - EUCOMM (ID: 93474)

Ddit4l MGI:1920534 ENSMUSG00000046818 OTTMUSG00000035296
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000053855 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MVATGSLSSKNPASISELLDGGYHPGSLLS

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000586616 UTR UTR
ENSMUSE00000990481 UTR + start codon + CDS
ENSMUSE00000360171 RTP801-like (119/119 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000165845 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MVATGSLSSKNPASISELLDGGYHPGSLLS

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000883076 UTR + start codon + CDS
ENSMUSE00000887366 RTP801-like (35/36 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000167564 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available