IKMC Project Report - EUCOMM (ID: 93540)

Fxn MGI:1096879 ENSMUSG00000059363 OTTMUSG00000031872
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000081333 protein_coding No protein product (NMD) view

Predicted translation:

MWAFGGRAAVGLLPRTASRASAWVGNPRWREPIVTCGRRGLHVTVNAGATRHALSRRDSV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000145253 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000481984 CDS Deleted
ENSMUSE00001000166 Frataxin-like (37/110 aa) CDS CDS + stop codon + UTR
ENSMUSE00001054082 Frataxin-like (33/110 aa) CDS
ENSMUSE00000726461 Frataxin-like (41/110 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000123684 nonsense_mediated_decay No protein product (NMD) view

Predicted translation:

MWAFGGRAAVGLLPRTASRASAWVGNPRWREPIVTCGRRGLHVTVNAGATRHALSRRDSV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000783809 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000481984 CDS Deleted
ENSMUSE00000803080 CDS CDS + stop codon + UTR
ENSMUSE00001066951 CDS + stop codon + UTR
ENSMUSE00000833744 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000132688 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available