IKMC Project Report - EUCOMM (ID: 93920)

Mcm10 MGI:1917274 ENSMUSG00000026669 OTTMUSG00000010867
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027980 protein_coding No protein product (NMD) view

Predicted translation:

MDVEEDDLCLLTSLLEENEAVLPCSSEKDKSLSLGDGDPDEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGD
VEDLTDDEVATSKVGNSGPPPAPSQEKTSEELQDELKKLQEQMKSLQEQLKAASIKQPPGTAPLQEPPDSSLQPLLKEKR
IRRIQESACFSAELDVPTLPKAKRVARKPKTPAESSSRMRTPAQPLQVSSSFLEPNHSSSSRSSTPSPQAVPGNKCSRTI
RNQNTVSPGNSGDRPQQVSQVSVEAFSGLRLRGKRLASGN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000701397 UTR UTR
ENSMUSE00001085812 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001010705 CDS CDS
ENSMUSE00001054877 CDS CDS
ENSMUSE00000983198 CDS CDS
ENSMUSE00000431015 CDS CDS
ENSMUSE00000335197 CDS Deleted
ENSMUSE00001036824 CDS CDS + stop codon + UTR
ENSMUSE00000984969 Znf_Mcm10/DnaG (24/46 aa) CDS
ENSMUSE00001040901 Znf_Mcm10/DnaG (22/46 aa) CDS
ENSMUSE00001019885 CDS
ENSMUSE00001022344 Rep_factor_Mcm10 (21/346 aa) CDS
ENSMUSE00001090884 Rep_factor_Mcm10 (37/346 aa) CDS
ENSMUSE00001010858 Rep_factor_Mcm10 (77/346 aa) CDS
ENSMUSE00001008282 Rep_factor_Mcm10 (49/346 aa) CDS
ENSMUSE00001049064 Rep_factor_Mcm10 (38/346 aa) CDS
ENSMUSE00000970635 Rep_factor_Mcm10 (38/346 aa) CDS
ENSMUSE00001025783 Rep_factor_Mcm10 (49/346 aa) CDS
ENSMUSE00001016474 Rep_factor_Mcm10 (15/346 aa) CDS
ENSMUSE00001036483 Rep_factor_Mcm10 (26/346 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000102985 protein_coding No protein product (NMD) view

Predicted translation:

MDVEEDDLCLLTSLLEENEAVLPCSSEKDKSLSLGDGDPDEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGD
VEDLTDDEVATSKVGNSGPPPAPSQEKTSEELQDELKKLQEQMKSLQEQLKAASIKQPPGTAPLQEPPDSSLQPLLKEKR
IRRIQESACFSAELDVPTLPKAKRVARKPKTPAESSSRMRTPAQPLQVSSSFLEPNHSSSSRSSTPSPQAVPGNKCSRTI
RNQNTVSPGNSGDRPQQVSQVSVEAFSGLRLRGKRLASGN*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000660938 UTR UTR
ENSMUSE00001085812 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001010705 CDS CDS
ENSMUSE00001054877 CDS CDS
ENSMUSE00000983198 CDS CDS
ENSMUSE00000431015 CDS CDS
ENSMUSE00000335197 CDS Deleted
ENSMUSE00001036824 CDS CDS + stop codon + UTR
ENSMUSE00000984969 Znf_Mcm10/DnaG (24/46 aa) CDS
ENSMUSE00001040901 Znf_Mcm10/DnaG (22/46 aa) CDS
ENSMUSE00001019885 CDS
ENSMUSE00001022344 Rep_factor_Mcm10 (21/346 aa) CDS
ENSMUSE00001090884 Rep_factor_Mcm10 (37/346 aa) CDS
ENSMUSE00001010858 Rep_factor_Mcm10 (77/346 aa) CDS
ENSMUSE00001008282 Rep_factor_Mcm10 (49/346 aa) CDS
ENSMUSE00001049064 Rep_factor_Mcm10 (38/346 aa) CDS
ENSMUSE00000970635 Rep_factor_Mcm10 (38/346 aa) CDS
ENSMUSE00001025783 Rep_factor_Mcm10 (49/346 aa) CDS
ENSMUSE00001016474 Rep_factor_Mcm10 (15/346 aa) CDS
ENSMUSE00000660935 Rep_factor_Mcm10 (26/346 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000125201 retained_intron No analysis available: incomplete transcript
ENSMUST00000150091 retained_intron Target region does not overlap transcript
ENSMUST00000125349 retained_intron Target region does not overlap transcript
ENSMUST00000139882 retained_intron Target region does not overlap transcript
ENSMUST00000125851 retained_intron Target region does not overlap transcript
ENSMUST00000151533 retained_intron Target region does not overlap transcript
ENSMUST00000129443 processed_transcript Target region does not overlap transcript
ENSMUST00000146257 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0756_3_C12 PG00244_Z_1_H08 Mcm10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_E11 PG00244_Z_1_H08 Mcm10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_E12 PG00244_Z_1_H08 Mcm10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_C11 PG00244_Z_1_H08 Mcm10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_D12 PG00244_Z_1_H08 Mcm10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_E10 PG00244_Z_1_H08 Mcm10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_G10 PG00244_Z_1_H08 Mcm10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_D11 PG00244_Z_1_H08 Mcm10tm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0756_3_H11 PG00244_Z_1_H08 Mcm10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_A11 PG00244_Z_1_H08 Mcm10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_F12 PG00244_Z_1_H08 Mcm10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_B10 PG00244_Z_1_H08 Mcm10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_G11 PG00244_Z_1_H08 Mcm10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_F09 PG00244_Z_1_H08 Mcm10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_F11 PG00244_Z_1_H08 Mcm10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_B11 PG00244_Z_1_H08 Mcm10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0756_3_D10 PG00244_Z_1_H08 Mcm10tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 372100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00244_Z_1_H08 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00244_Z_5_F12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00244_Z_1_F11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00244_Z_1_E07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00244_Z_1_F12 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 372100 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00244_Z_1_C04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
372100 Knockout First, Reporter-tagged insertion with conditional potential PCS00244_A_A04