IKMC Project Report - EUCOMM (ID: 93971)

F13a1 MGI:1921395 ENSMUSG00000039109
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000037491 protein_coding No protein product (NMD) view

Predicted translation:

MSDTPASTFGGRRAVPPNNSNAAEVDLPTEELQGLVPRGVNLKDYLNVTAVHLFKERWDSNKIDHHTDKYDNNKLIVRRG
QTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPVPVVKELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRM
YVAVWTPYGILRTRRDPETDTYILFNPWCEVRRRHPGYLLVCDGQS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000683177 UTR UTR
ENSMUSE00000292915 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000292907 Transglutaminase_N (61/121 aa) CDS CDS
ENSMUSE00000292898 Transglutaminase_N (61/121 aa) CDS CDS
ENSMUSE00000292891 CDS Deleted
ENSMUSE00000292885 CDS CDS + stop codon + UTR
ENSMUSE00000292879 Transglutaminase-like (14/87 aa) CDS
ENSMUSE00000292873 Transglutaminase-like (47/87 aa) CDS
ENSMUSE00000292857 Transglutaminase-like (28/87 aa) CDS
ENSMUSE00000292842 CDS
ENSMUSE00000292952 CDS
ENSMUSE00000292944 Transglutaminase_C (63/104 aa) CDS
ENSMUSE00000292932 Transglutaminase_C (42/104 aa) | Transglutaminase_C (5/97 aa) CDS
ENSMUSE00000292925 Transglutaminase_C (46/97 aa) CDS
ENSMUSE00000451475 Transglutaminase_C (47/97 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000164727 protein_coding No protein product (NMD) view

Predicted translation:

MSDTPASTFGGRRAVPPNNSNAAEVDLPTEELQGLVPRGVNLKDYLNVTAVHLFKERWDSNKIDHHTDKYDNNKLIVRRG
QTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPVPVVKELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRM
YVAVWTPYGILRTRRDPETDTYILFNPWCEVRRRHPGYLLVCDGQS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000679696 UTR UTR
ENSMUSE00000292915 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000292907 Transglutaminase_N (61/121 aa) CDS CDS
ENSMUSE00000292898 Transglutaminase_N (61/121 aa) CDS CDS
ENSMUSE00000292891 CDS Deleted
ENSMUSE00000292885 CDS CDS + stop codon + UTR
ENSMUSE00000292879 Transglutaminase-like (14/87 aa) CDS
ENSMUSE00000292873 Transglutaminase-like (47/87 aa) CDS
ENSMUSE00000292857 Transglutaminase-like (28/87 aa) CDS
ENSMUSE00000292842 CDS
ENSMUSE00000292952 CDS
ENSMUSE00000292944 Transglutaminase_C (63/104 aa) CDS
ENSMUSE00000292932 Transglutaminase_C (42/104 aa) | Transglutaminase_C (5/97 aa) CDS
ENSMUSE00000292925 Transglutaminase_C (46/97 aa) CDS
ENSMUSE00000451475 Transglutaminase_C (47/97 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 388122 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00257_Z_1_D01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
388122 Knockout-First - Reporter Tagged Insertion PCS00257_A_A09