IKMC Project Report - EUCOMM (ID: 97201)

1110002L01Rik MGI:1915821 ENSMUSG00000071456 OTTMUSG00000042304
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000180149 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MVCGSDVWRSHPPGRSSGGNRICSFRERLIARLRAACVEEWLWKLKEPDDQVILPTTVLISMFYFVVVQAQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001089796 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000982465 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000179637 nonsense_mediated_decay Residual N-terminal, unknown C-terminal view

Predicted translation: 

MVCGSDVWRSHPPGRSSGGNRICSFRERLIARLRAACVEEWLWKLKEPDDQVILPTTVLISMFYFVVVQAQACYFKLVII
FMEAETGELLLGPCQPGLH

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000616811 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001079123 CDS CDS + stop codon + UTR
ENSMUSE00001093811 CDS + stop codon + UTR Deleted
ENSMUSE00000966732 UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000168012 nonsense_mediated_decay Residual N-terminal, unknown C-terminal view

Predicted translation: 

MVCGSDVWRSHPPGRSSGGNRICSFRERLIARLRAACVEEWLWKLKEPDDQVILPTTVLISMFYFVVVQAQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001000915 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001087392 CDS + stop codon + UTR Deleted
ENSMUSE00001006173 UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000095903 nonsense_mediated_decay Residual N-terminal, unknown C-terminal view

Predicted translation: 

MVCGSDVWRSHPPGRSSGGNRICSFRERLIARLRAACVEEWLWKLKEPDDQVILPTTVLISMFYFVVVQAQ

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000967744 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000965770 CDS + stop codon + UTR Deleted
ENSMUSE00000616809 UTR Deleted
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0833_2_H08 PG00267_Y_8_C07 1110002L01Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0833_2_G06 PG00267_Y_8_C07 1110002L01Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0833_2_A07 PG00267_Y_8_C07 1110002L01Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0833_2_E07 PG00267_Y_8_C07 1110002L01Riktm1a(EUCOMM)Hmgu Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00267_Y_8_C07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00267_Z_8_C07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00267_Z_8_F02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00267_Z_8_F04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PGS00267_Z_8_E03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PGS00267_Z_8_F02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00267_Y_8_F11 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PGS00267_Z_8_C07 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00267_Z_8_E03 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 415443 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PGS00267_Z_8_F04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors no data available