IKMC Project Report - EUCOMM (ID: 98750)

Peli2 MGI:1891445 ENSMUSG00000021846
Pre-pipeline Designs Vectors ES Cells Mice
Design Requested

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000073150 protein_coding No protein product (NMD) view

Predicted translation:

MFSPGQEEPSAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRTYASGVKPSTIHMVSTPQASKAISSRGHHSIS
YTLSRSQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTVSGGQNEDAQITQSTISRRKQQNGKTLMDTWMDSLPTVSW*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001016020 Pellino (21/415 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000331235 Pellino (44/415 aa) CDS CDS
ENSMUSE00000994803 Pellino (34/415 aa) CDS CDS
ENSMUSE00000121370 Pellino (34/415 aa) CDS CDS
ENSMUSE00000121370 Pellino (32/415 aa) CDS Deleted
ENSMUSE00000121372 Pellino (63/415 aa) CDS CDS + stop codon + UTR
ENSMUSE00000514311 Pellino (188/415 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available