IKMC Project Report - EUCOMM (ID: 99743)

1500009C09Rik MGI:1923755 ENSMUSG00000068099 OTTMUSG00000033544
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000136948 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MTDAESPG

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000787519 UTR + start codon + CDS
ENSMUSE00000845623 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000143238 protein_coding No protein product view

Predicted translation: 

MWGAAERRVFDSKERYQGAKPTQDCYLLAHSEASRPDKLHLPWEQWPVALCL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000724357 UTR UTR
ENSMUSE00000781600 Deleted
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 375457 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04032_Z_2_A04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 375457 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) HTGR04032_Z_2_H04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
375457 Knockout-First - Reporter Tagged Insertion PCS04032_A_B04