IKMC Project Report - EUCOMM (ID: 100004)

1700014D04Rik MGI:1921474 ENSMUSG00000051054 OTTMUSG00000042351
Pre-pipeline Designs Vectors ES Cells Mice
Design Completed

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000180139 protein_coding No protein product view

Predicted translation:

MKKKMSPQTLEEVKKRDDISPDPKRSEGKLTALWNSQGSTVTNLDTQVPKINLKLKGKRKYFGAYDQVLYVKIPEGDLGQ
KHSQLFWGLPSLHSESIMATLLVPASSYSPEPCLVLFNGVCKTASAPVLSHGLPALPQPLTLVHPQPLPKVAPQPQTLTE
GMPQVHMQSPLSSMALPSLPCGSALQIPQTRTVSDVLNGKGHLQYHLVQNPQDSLWGLVPECQQYETALGLPVHSFPVGS
QSSQTYVSVPGSGLFHFSSEHQNNLDPYGPNNLTSPSCFELCNRPGVPEVMNTQFNPTGVSSYCYKYATSQCCVHWGNIC
ADPGNGELSHSESYCVKVPMKPQLRKDAAKNLGQILGKCPLDNTQMISGCCILNGLKTIPETEGESVCHSRTSLENEQLT
ISKKNLDQRHMRSILRLHMS

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000992968 UTR UTR
ENSMUSE00001022109 UTR + start codon + CDS UTR
ENSMUSE00001022109 CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000055343 protein_coding No protein product
ENSMUST00000178508 protein_coding Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available