IKMC Project Report - KOMP-CSD (ID: 116177)

Naaladl1 MGI:2685810 ENSMUSG00000054999 OTTMUSG00000035402
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000044451 protein_coding No protein product (NMD) view

Predicted translation:

MHWVKILGVALGAAALLGLGIILGHFAIPKATSPLTSSTSDSQDLDLAILDSVMGQLDASRIRENLRELSKEPHVATSPR
DEALVQLLLGRWKDTATGLDSAKTYEYRVLLSFPNAEQPNSVEVVGPNGTTFHSFQPFEKNLTGEQAGPNVLQPYAAYAP
PGTPKGLLVYANQGSEEDFKELETQGINLEGTIALTRYGGVGRGAKAPGDPAGPSYLPAGEQRNSDSLALQNLQRSFSAS
CRSARWPTSMWTSLFSPMLPSGHREHLLYKV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000378784 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000230823 CDS CDS
ENSMUSE00000230807 Protease-assoc_domain (5/70 aa) CDS CDS
ENSMUSE00000230781 Protease-assoc_domain (41/70 aa) CDS CDS
ENSMUSE00000230761 Protease-assoc_domain (24/70 aa) CDS Deleted
ENSMUSE00000230744 CDS Deleted
ENSMUSE00000230728 CDS Deleted
ENSMUSE00000230713 Peptidase_M28 (38/194 aa) CDS Deleted
ENSMUSE00000230702 Peptidase_M28 (29/194 aa) CDS CDS
ENSMUSE00000230685 Peptidase_M28 (22/194 aa) CDS CDS
ENSMUSE00000403341 Peptidase_M28 (23/194 aa) CDS CDS + stop codon + UTR
ENSMUSE00000362693 Peptidase_M28 (31/194 aa) CDS
ENSMUSE00000230617 Peptidase_M28 (31/194 aa) CDS
ENSMUSE00000230594 Peptidase_M28 (23/194 aa) CDS
ENSMUSE00000230575 TFR-like_dimer_dom (4/122 aa) CDS
ENSMUSE00000230559 TFR-like_dimer_dom (30/122 aa) CDS
ENSMUSE00000230537 TFR-like_dimer_dom (32/122 aa) CDS
ENSMUSE00000452893 TFR-like_dimer_dom (59/122 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available